DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cer and si:dkey-26g8.5

Sequence 1:NP_611420.1 Gene:cer FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001096585.1 Gene:si:dkey-26g8.5 ZFINID:ZDB-GENE-121214-19 Length:335 Species:Danio rerio

Alignment Length:75 Identity:30/76 (39%)
Similarity:46/76 (61%) Gaps:1/76 (1%)


  Fly     6 DEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQ 70
            |:.|..:||:..|:|..:.::.||.|:.|:..:||:||.::..|..|:|||:|...|:|.|||.|
Zfish    25 DDHWNSWKSQHGKSYHEDLEVGRRMIWEENLRKIEQHNFEYSYGNHTFKMGMNQFGDMTNEEFRQ 89

  Fly    71 RC-GKKVPPN 79
            .. |.|..||
Zfish    90 AMNGYKHDPN 99

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:285458 23/59 (39%)
si:dkey-26g8.5NP_001096585.1 Inhibitor_I29 28..86 CDD:214853 22/58 (38%)
Peptidase_C1 115..334 CDD:278538
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.