DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cer and zgc:103438

Sequence 1:NP_611420.1 Gene:cer FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001006036.1 Gene:zgc:103438 ZFINID:ZDB-GENE-041010-131 Length:311 Species:Danio rerio

Alignment Length:62 Identity:15/63 (24%)
Similarity:33/63 (52%) Gaps:5/63 (8%)


  Fly    12 YKSKFDKNYEAEEDLMRRR-IYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQRC 72
            :|.||::.|::|::..:|. |:..:...:...||.    .:::.:|||..:|.:..|..:.|
Zfish   254 FKEKFNQQYKSEKEHEKREIIFVHTLRFVHSRNRV----GLSFSLGINDRSDWSRAEKRKYC 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:285458 14/57 (25%)
zgc:103438NP_001006036.1 Inhibitor_I29 251..306 CDD:285458 13/56 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.