DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cer and ctsc

Sequence 1:NP_611420.1 Gene:cer FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_012812143.1 Gene:ctsc XenbaseID:XB-GENE-940480 Length:458 Species:Xenopus tropicalis

Alignment Length:88 Identity:18/89 (20%)
Similarity:32/89 (36%) Gaps:23/89 (26%)


  Fly     6 DEEWVEYKSKFDKNYEAE----------EDLMRR------RIYAESKARIEEHNRKFEKGEVTWK 54
            :.::|:..::..|::.|.          |||:||      ||....:......:.|::.....|.
 Frog   167 NHDFVKQINEVQKSWTATAYPEYEGMTIEDLIRRAGGRNSRIPMRPRPAPLPTDEKYQGLPTEWD 231

  Fly    55 ----MGINHLADLTPEEFAQRCG 73
                .|.|.   :||......||
 Frog   232 WRNIAGYNF---VTPVRNQASCG 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:285458 16/79 (20%)
ctscXP_012812143.1 PTZ00049 7..454 CDD:240244 18/89 (20%)
CathepsinC_exc 21..136 CDD:285926
Peptidase_C1A_CathepsinC 226..455 CDD:239112 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.