DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and ctss1

DIOPT Version :10

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_017207692.2 Gene:ctss1 / 393398 ZFINID:ZDB-GENE-040426-1583 Length:375 Species:Danio rerio


Alignment Length:74 Identity:22/74 - (29%)
Similarity:40/74 - (54%) Gaps:7/74 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVSDE------EWVEYKSKFDKNY-EAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGIN 58
            :|||..|      :|..:||:.:|.| ...|:.:||.::.::...|..||.....|..::.:|:|
Zfish    60 VSLVGCEIRRLTNQWTTWKSQHNKTYRNTREERLRRSVWKQNLQDILLHNEAAAVGLHSYTLGLN 124

  Fly    59 HLADLTPEE 67
            .|:|:|.:|
Zfish   125 QLSDMTADE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 18/60 (30%)
ctss1XP_017207692.2 Inhibitor_I29 74..133 CDD:214853 17/58 (29%)
Peptidase_C1A 161..373 CDD:239068
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.