DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and CtsL2

DIOPT Version :10

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_610906.1 Gene:CtsL2 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster


Alignment Length:59 Identity:20/59 - (33%)
Similarity:32/59 - (54%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQRCGKKV 76
            |.|..||.:.|..|:|...:.|...|:..:.|...:::|:|.|||:|.:|.|...|.|:
  Fly    47 KVYSDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIATLLGSKI 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 16/49 (33%)
CtsL2NP_610906.1 Inhibitor_I29 38..97 CDD:462410 16/49 (33%)
Peptidase_C1A 131..350 CDD:239068
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.