DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cer and Ctsj

Sequence 1:NP_611420.1 Gene:cer FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001343220.1 Gene:Ctsj MGIID:1349426 Length:334 Species:Mus musculus

Alignment Length:63 Identity:22/64 (34%)
Similarity:39/64 (61%) Gaps:0/64 (0%)


  Fly     6 DEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEF 68
            |.||.::|:|:.|:|..:|:.:||.::.|:...|:.||::...|:..:.|.:|...|.|.|||
Mouse    26 DAEWKDWKTKYAKSYSPKEEALRRAVWEENMRMIKLHNKENSLGKNNFTMKMNKFGDQTSEEF 88

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:285458 19/59 (32%)
CtsjNP_001343220.1 Inhibitor_I29 29..87 CDD:214853 18/58 (31%)
Peptidase_C1 114..331 CDD:306594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.