DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cer and Ctsh

Sequence 1:NP_611420.1 Gene:cer FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_037071.1 Gene:Ctsh RGDID:2447 Length:333 Species:Rattus norvegicus

Alignment Length:71 Identity:17/72 (24%)
Similarity:35/72 (49%) Gaps:4/72 (6%)


  Fly     9 WVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQRCG 73
            :..:..:..|.|.:.|...|.:::|.:..:|:.||::    ..|:|||:|..:|::..|...:..
  Rat    33 FTSWMKQHQKTYSSREYSHRLQVFANNWRKIQAHNQR----NHTFKMGLNQFSDMSFAEIKHKYL 93

  Fly    74 KKVPPN 79
            ...|.|
  Rat    94 WSEPQN 99

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:285458 15/59 (25%)
CtshNP_037071.1 PTZ00203 1..330 CDD:185513 17/72 (24%)
Inhibitor_I29 33..88 CDD:285458 15/59 (25%)
Peptidase_C1 115..330 CDD:278538
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.