DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and Y113G7B.15

DIOPT Version :10

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_507904.2 Gene:Y113G7B.15 / 190976 WormBaseID:WBGene00013764 Length:362 Species:Caenorhabditis elegans


Alignment Length:66 Identity:21/66 - (31%)
Similarity:32/66 - (48%) Gaps:7/66 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KNYE--AEEDLMRRRI--YAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQRCGKKVPP 78
            |:|.  ||:|   ||:  :|::..:|:|.|.|..:.......|.|..||...:|.:.|..|..|.
 Worm    39 KHYRTPAEKD---RRLAHFAKNHQKIQELNAKARREGRNVTFGWNKFADKNRQELSARNSKIHPK 100

  Fly    79 N 79
            |
 Worm   101 N 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 16/53 (30%)
Y113G7B.15NP_507904.2 Inhibitor_I29 30..90 CDD:462410 16/53 (30%)
Peptidase_C1A 132..358 CDD:239068
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.