DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and CTSW

DIOPT Version :10

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001326.3 Gene:CTSW / 1521 HGNCID:2546 Length:376 Species:Homo sapiens


Alignment Length:63 Identity:20/63 - (31%)
Similarity:34/63 - (53%) Gaps:4/63 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YKSKFDKNY-EAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQRCG 73
            ::.:|:::| ..||...|..|:|.:.|:.:   |..|:...|.:.|:...:|||.|||.|..|
Human    45 FQIQFNRSYLSPEEHAHRLDIFAHNLAQAQ---RLQEEDLGTAEFGVTPFSDLTEEEFGQLYG 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 16/56 (29%)
CTSWNP_001326.3 Inhibitor_I29 42..98 CDD:214853 15/55 (27%)
Peptidase_C1A 129..358 CDD:239068
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.