DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10062 and Naalad2

DIOPT Version :10

Sequence 1:NP_001261089.1 Gene:CG10062 / 37224 FlyBaseID:FBgn0034439 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_001344328.1 Gene:Naalad2 / 72560 MGIID:1919810 Length:778 Species:Mus musculus


Alignment Length:232 Identity:56/232 - (24%)
Similarity:85/232 - (36%) Gaps:65/232 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 MHWEMVNMYQGIQNVVVKLSEKNSTN-ENYLLINSHYDS-VPGSPGAGDDGSMVVTMLEVMRVIA 186
            ||...:|....|.||:..:  :.||. :.|:::..|.|| |.|       |....|...|::.||
Mouse   372 MHVNNINKITRIYNVIGTI--RGSTEPDRYVILGGHRDSWVFG-------GIDPTTGTAVLQEIA 427

  Fly   187 KSGDPLAH-------PIVFLFNGAEENPLQASHAFITQHKWA-KNCK-------ALINLDSAGSG 236
            :|...|.:       .|:|....|||..|..|      .:|| :|.|       |.||.|||..|
Mouse   428 RSFGKLVNGGWRPRRTIIFASWDAEEFGLLGS------TEWAEENAKLLQERSIAYINSDSAIEG 486

  Fly   237 GREILFQSGPNHPWLMNYY-----RNVPHPFANTLAEELFQA----------------GYIPSDT 280
            ...:.....|    |:|..     |.:..|.....::.|:::                ..:.|.:
Mouse   487 NYTLRVDCTP----LLNQLVYKVAREISSPDDGFESKSLYESWLEKDPSPENKECPRINKLGSGS 547

  Fly   281 DFRIFRDYGGVPGLDMAYI-------FNGY-VYHTKY 309
            ||..:....|:......|.       ::.| ||||.|
Mouse   548 DFEAYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIY 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10062NP_001261089.1 M28_Fxna_like 59..364 CDD:349872 56/232 (24%)
Naalad2NP_001344328.1 Zinc_peptidase_like 86..>143 CDD:472712
PA_GCPII_like 148..374 CDD:239036 1/1 (100%)
M28_PSMA_like <382..623 CDD:349942 53/222 (24%)
TFR_dimer 655..774 CDD:461238
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.