DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and TRE2

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_014899.1 Gene:TRE2 SGDID:S000005782 Length:809 Species:Saccharomyces cerevisiae

Alignment Length:546 Identity:103/547 (19%)
Similarity:177/547 (32%) Gaps:182/547 (33%)


  Fly    21 NVDPL-LRPRGSQQYEAQPNGCERAFVQGNKIKWFWAPA---FFGFWLLLYVTISIPACHRLPRP 81
            |:|.: .:|.|..||...         ..:.:.|..:|.   ...||                  
Yeast   325 NIDVVQSKPVGLPQYSTG---------DASGLNWDGSPVEEKDHKFW------------------ 362

  Fly    82 LTIQDEETH-PDQFIAERAEKNLRELVSLGPRVVGSRQNEMAALKMLSQKMQKIRSGTANDIEVD 145
                 .:|| |...|:.|..|.|...:|.|...|....::            :..||...|:.:|
Yeast   363 -----RQTHIPTIPISTRQGKELLSRLSSGGVTVDDGNSD------------RSNSGKMGDVLID 410

  Fly   146 VQVASGSYVHWSMVNMYQSIQNIVVKISPKNTNSTTYLLVNSHYDSVPAG---PGAGDDGSMVAT 207
            |.:.:.       |.....|.|||.||..:..:....::..|. :|:..|   |..|     .|.
Yeast   411 VDLQTN-------VREKHFIPNIVGKIEGREQSDKAIIIAASR-NSINFGTTYPNFG-----TAA 462

  Fly   208 MMEVLRVLAKSD-----KPLKNPVVFLFNGAEENPLQASHAF---ITQHKWAKYCKALINLDSCG 264
            ::.::::..:..     |||:|.....|.|.|.|...:|...   :|..|...|  :||::...|
Yeast   463 LLSIVQLFQEVKYKFGWKPLRNIYFISFGGTEFNYAGSSELVEQRLTPLKDEIY--SLIDISQLG 525

  Fly   265 --------NGGR--EILFQSGPNHPWLMKNYRR-----------AIKH-----PY------ASTM 297
                    ||..  |:..::   ||.|.|.:.|           .::|     |:      .|.:
Yeast   526 IPFAEKYENGKTRGELSIET---HPLLKKFFNRNAHGNFDISVDNVQHYGDWTPFLANGIPVSVI 587

  Fly   298 GEELFQHNFIPSDT----------------------DFRIFRDHGSVPGLDMAYTYNGFVYHTRH 340
            ..:..::...|::|                      |..::..|.|:..:|              
Yeast   588 SSDSTRNRDTPTETSEDKFERVEKILEDEQNQQSVKDLLVYLLHISMELID-------------- 638

  Fly   341 DKAEIFPRGSFQHTGDNLLALVRQIANSPEIENSAKYAKGHTIYFDV--------MGWFLVFYTE 397
            |....|...|:....|..|..:.|.  .||..|.....||...:..:        .||..:.::.
Yeast   639 DPLLHFDIISYVEDIDERLQRLEQA--YPEKLNFTSIIKGLLFWKKIGSEWASWTQGWENIVWSH 701

  Fly   398 TEGVILNVIVSLVSIGICGYAFKLMSVN------SGIKLEKILKKV--GHTLLVQILSVVVGAI- 453
            .:|    :..||:||....:..||.::.      :|:......|.|  |.||:.:..|...|.: 
Yeast   702 GDG----IEPSLLSINRWTWNKKLTNIGRRTCSPAGLPNRSFYKNVLFGPTLIQEDKSKNGGNVD 762

  Fly   454 ---LPVLLGLFMDAVHLPLSWFSNSW 476
               .|.:    |||:      :.:.|
Yeast   763 FWTFPGV----MDAI------YDDDW 778

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 71/377 (19%)
TRE2NP_014899.1 PA 249..392 CDD:238300 20/99 (20%)
M28_PMSA_TfR_like 413..643 CDD:193496 46/262 (18%)
TFR_dimer 673..796 CDD:309400 24/121 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.