DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11961 and VPS70

DIOPT Version :9

Sequence 1:NP_001246418.1 Gene:CG11961 / 37221 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_012660.1 Gene:VPS70 / 853590 SGDID:S000003887 Length:811 Species:Saccharomyces cerevisiae


Alignment Length:355 Identity:78/355 - (21%)
Similarity:132/355 - (37%) Gaps:81/355 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RLPR----PLTIQDEETHPDQFIAERAEKNLRELVSLGPRVVGSRQNEMAALKMLSQKMQKIRSG 137
            |:||    |::.:|.     |.|.||.  |.|.. .:||   ||...:..:....|..:.|:.  
Yeast   361 RVPRIPSVPMSARDV-----QPILERL--NGRGF-QIGP---GSNIKDFGSFTGPSSSIDKVH-- 412

  Fly   138 TANDIEVDVQVASGSYVHWSMVNMYQSIQNIVVKISPKNTNSTTYLLVNSHYDSVPAGPGAGDDG 202
            ..|::..:::..|.                  |::|.....:...:::.:|.||: |...|||..
Yeast   413 LHNELTYNIKEMSS------------------VEVSIPGIFTEGEIIIGAHRDSL-ASSSAGDAN 458

  Fly   203 SMVATMMEVLRVLAK----SDKPLKNPVVFLFNGAEENPLQAS------HAFITQHKWAKYCKAL 257
            |..|.::|:.|.::|    ..|||: |:..:....|.:.|..|      ||.|.:.:...|    
Yeast   459 SGSAILLEIARGMSKLLKHGWKPLR-PIKLISWDGERSGLLGSTDYAEAHAAILRRRALVY---- 518

  Fly   258 INLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEE---LFQH---------NFIPSD 310
            :|||:..:|..   |....| |.|......|.|  .....|.|   ||.|         :.:...
Yeast   519 LNLDNAISGTN---FHCKAN-PLLQDVIYEAAK--LTEFNGHEDWSLFDHWKYTSNATISLLDGL 577

  Fly   311 TDFRIFRDHGSVPGLDMAYTYN---GFVYHTR--HDK---AEIFPRGSFQ-HTGDNLLALVRQIA 366
            :.:..|:.|..||.....:..|   |.|||:.  .|.   .|.|....:: |   |.:|:...:.
Yeast   578 SSYTSFQYHLGVPAAHFQFNANDTSGAVYHSNSVFDSPTWLEKFTNSDYKLH---NTMAMFVGLT 639

  Fly   367 NSPEIENSAKYAKGHTIYFDVMGWFLVFYT 396
            .....||.......|.....:..|::.:::
Yeast   640 TLMLSENELARFNTHVYLKKIYNWYIAWHS 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 73/334 (22%)
VPS70NP_012660.1 Zinc_peptidase_like 135..>187 CDD:417508
PA_GCPII_like 187..413 CDD:239036 17/64 (27%)
M28_PMSA_TfR_like 419..649 CDD:349871 58/262 (22%)
TFR_dimer <731..799 CDD:398094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.