DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and Folh1

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_476533.1 Gene:Folh1 RGDID:70963 Length:752 Species:Rattus norvegicus

Alignment Length:423 Identity:92/424 (22%)
Similarity:152/424 (36%) Gaps:105/424 (25%)


  Fly    47 QGNKIKWFWAPAFFGFWLLLYVTISIPACHRLPRPLTIQDEETHPDQFI-----AERAEKNLREL 106
            :|||:|........|  ::||   |.||.:.:|      ..:::||.:.     .:|.  |:..|
  Rat   212 RGNKVKNAQLAGAKG--IILY---SDPADYFVP------GVKSYPDGWNLPGGGVQRG--NVLNL 263

  Fly   107 VSLG-PRVVGSRQNEMA-------ALKMLS-----------QKMQKIRSGTA-------NDIEVD 145
            ...| |...|...||.|       |:.:.|           ||:.:...|:|       ..::|.
  Rat   264 NGAGDPLTPGYPANEYAYRHEFTEAVGLPSIPVHPIGYDDAQKLLEHMGGSAPPDSSWKGGLKVP 328

  Fly   146 VQVASGSYVHWSM------VNMYQSIQNI--VVKISPKNTNSTTYLLVNSHYDSVPAGPGAGDDG 202
            ..|..|...::|.      ::.|..:..|  |:...........|:::..|.|:...  |..|..
  Rat   329 YNVGPGFAGNFSKQKVKLHIHSYNKVTRIYNVIGTLKGAVEPDRYVILGGHRDAWVF--GGIDPQ 391

  Fly   203 SMVATMMEVLRVLA----KSDKPLKNPVVFLFNGAEENPLQAS------HAFITQHKWAKYCKAL 257
            |..|.:.|::|...    |..:| :..::|....|||..|..|      |:.:.|.:...|    
  Rat   392 SGAAVVHEIVRTFGTLKKKGWRP-RRTILFASWDAEEFGLLGSTEWAEEHSRLLQERGVAY---- 451

  Fly   258 INLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQH--------NFI------- 307
            ||.||...|...:.....|....|:.|..:.:..|.....|:.|:..        .||       
  Rat   452 INADSSIEGNYTLRVDCTPLMHSLVYNLTKELPSPDEGFEGKSLYDSWKEKSPSTEFIGMPRISK 516

  Fly   308 -PSDTDFRIFRDHGSVPGLDMAYTYNGF--------VYHTRHDKAEIF-----PRGSFQHTGDNL 358
             .|..||.:|.....:......||.|..        :||:.::..|:.     |...:..|...:
  Rat   517 LGSGNDFEVFFQRLGIASGRARYTKNWKNNKVSSYPLYHSVYETYELVEKFYDPTFKYHLTVAQV 581

  Fly   359 L-ALVRQIANS---P-EIENSAKYAKGH--TIY 384
            . |:|.::|||   | :.::.|...|.|  |||
  Rat   582 RGAMVFELANSIVLPFDCQSYAVALKKHAETIY 614

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 81/380 (21%)
Folh1NP_476533.1 Zinc_peptidase_like 70..>116 CDD:301362
PA_GCPII_like 122..348 CDD:239036 32/149 (21%)
NAALADase 276..589 63/320 (20%)
M28_PSMA_like 336..597 CDD:193568 55/268 (21%)
Substrate binding. {ECO:0000250|UniProtKB:Q9Y3Q0} 519..520 1/1 (100%)
Substrate binding. {ECO:0000250|UniProtKB:Q04609} 536..538 0/2 (0%)
Substrate binding. {ECO:0000250|UniProtKB:Q9Y3Q0} 554..555 1/1 (100%)
TFR_dimer 634..749 CDD:282153
Substrate binding. {ECO:0000250|UniProtKB:Q9Y3Q0} 701..702
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.