DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and Naaladl1

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_113947.1 Gene:Naaladl1 RGDID:620987 Length:745 Species:Rattus norvegicus

Alignment Length:341 Identity:81/342 (24%)
Similarity:127/342 (37%) Gaps:62/342 (18%)


  Fly    38 PNGCERAFVQGNKIKWFWAPAFFGFWLLLYVTISIPACHRLPRPLTIQDEETHPDQFIAERAEKN 102
            |:|.||    |:..::|..|      |..|:. :.|...||. |..|......|.|.|.....||
  Rat   246 PSGVER----GSYYEYFGDP------LTPYLP-AHPVSFRLD-PHNISGFPPIPTQPIGFEDAKN 298

  Fly   103 LRELVSL-GPRVVGSRQNEMAALKMLSQKMQKIRSGTANDIEVDVQVASGSYVHWSMVNMYQSIQ 166
            |  |.:| |.....|.|..:..       ..|:..|    .|.:....:||.|..|:.|..: ::
  Rat   299 L--LCNLNGTSAPDSWQGALGC-------EYKLGPG----FEPNGNFPAGSEVKVSVYNRLE-LR 349

  Fly   167 NI--VVKISPKNTNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLA----KSDKPLKNP 225
            |.  |:.|.........|::..:|.||..  .||.|..|..|.::|:.|||.    |.....:..
  Rat   350 NSSNVLGIIQGAVEPDRYVIYGNHRDSWV--HGAVDPSSGTAVLLEISRVLGTLLKKGTWRPRRS 412

  Fly   226 VVFLFNGAEENPLQASHAFITQ--HKWAKYCKALINLDSCGNGGREILFQSGPNHPWLMKNYRRA 288
            ::|...||||..|..|..|..:  .|..:.....||:|........:..|..|....::.:..:.
  Rat   413 IIFASWGAEEFGLIGSTEFTEEFLSKLQERTVTYINVDISVFSNATLRAQGTPPVQSVIFSATKE 477

  Fly   289 IKHPYASTMGEELFQ------------HNFIPS------DTDFRIFRDHGSVPGLDMAYTY---- 331
            |..|.:|  |..::.            :..:||      .:|:..|.....:..:|:||||    
  Rat   478 ISAPGSS--GLSIYDNWIRYTNRSSPVYGLVPSMGTLGAGSDYASFIHFLGITSMDLAYTYDRSK 540

  Fly   332 -NGFVYHTRHDKAEIF 346
             :..:|.|.|...:.|
  Rat   541 TSARIYPTYHTAFDTF 556

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 67/289 (23%)
Naaladl1NP_113947.1 Zinc_peptidase_like 56..>126 CDD:301362
PA_GCPII_like 119..331 CDD:239036 28/110 (25%)
M28_PSMA_like 334..592 CDD:193568 53/229 (23%)
TFR_dimer 626..740 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.