DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and ERMP1

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_079172.2 Gene:ERMP1 HGNCID:23703 Length:904 Species:Homo sapiens

Alignment Length:843 Identity:257/844 (30%)
Similarity:436/844 (52%) Gaps:66/844 (8%)


  Fly    82 LTIQDEETHPDQFIAERAEKNLRELVSLGPRVVGSRQNEMAALKMLSQ--KMQKIRSGTANDIEV 144
            |.::....|..:|.|.:|...|..:.|:|||..||.:||:..:..|.:  |:.:::|.:.:.|.|
Human    95 LVLRGAAGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISV 159

  Fly   145 DVQVASGSY---VHWSMVNMYQSIQNIVVKISPKNTNSTTYLLVNSHYDSVPAGPGAGDDGSMVA 206
            |||..:||:   ......:.|.:|.|:|||:.|:: .:...:|.|.|:|||...|||.||....:
Human   160 DVQRPTGSFSIDFLGGFTSYYDNITNVVVKLEPRD-GAQHAVLANCHFDSVANSPGASDDAVSCS 223

  Fly   207 TMMEVLRVLAKSDKPLKNPVVFLFNGAEENPLQASHAFITQHKWAKYCKALINLDSCGNGGREIL 271
            .|:||||||:.|.:.|.:.|:|||||||||.|||||.|||||.||...:|.|||::.|.||:|::
Human   224 VMLEVLRVLSTSSEALHHAVIFLFNGAEENVLQASHGFITQHPWASLIRAFINLEAAGVGGKELV 288

  Fly   272 FQSGPNHPWLMKNYRRAIKHPYASTMGEELFQHNFIPSDTDFRIFRDHGSVPGLDMAYTYNGFVY 336
            ||:||.:|||::.|..|.|||:||.:.:|:||...|||||||||:||.|::||:|:|:..||::|
Human   289 FQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIY 353

  Fly   337 HTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEIENSAKYAKGHTIYFDVMGWFLVFYTETEGV 401
            ||::|.|:.....|.|..|||:||:::.:|.|..:..::||..|:.::|||:|.|::.|....|.
Human   354 HTKYDTADRILTDSIQRAGDNILAVLKHLATSDMLAAASKYRHGNMVFFDVLGLFVIAYPSRIGS 418

  Fly   402 ILNVIVSLVSIGICGYAFKLMSVNSGIKLEKILKKVGHTLLVQILSVVVGAILPVLLGLFMDAVH 466
            |:|.:|.:..:...|..|......:|...:..|..:|.||:....|:|...|:.|    |:..:.
Human   419 IINYMVVMGVVLYLGKKFLQPKHKTGNYKKDFLCGLGITLISWFTSLVTVLIIAV----FISLIG 479

  Fly   467 LPLSWFSNSWLILGLYFTTFFFGLAIVPAL--YFHWTKRDKLPIGQ---RVQLLLHCHCLLLSVL 526
            ..|||:::.::.:.||.|.....:.::..|  .|::.......:|:   .:.|.:|| |.|::: 
Human   480 QSLSWYNHFYVSVCLYGTATVAKIILIHTLAKRFYYMNASAQYLGEVFFDISLFVHC-CFLVTL- 542

  Fly   527 TLIFTICGIRSVFVLMLSCLFYTVGLIINIAT----KLHTKDVAWVIPHIVCTVPPFVFFAYFSH 587
                |..|:.|.|:   |.::....|:..:..    |.|.....::..:::....|:::..|...
Human   543 ----TYQGLCSAFI---SAVWVAFPLLTKLCVHKDFKQHGAQGKFIAFYLLGMFIPYLYALYLIW 600

  Fly   588 GFFTTFIPMFGRFGENLNPDLAVAVFSVAVGFLCCGFIIPVLQLFNKSKTIICGLMGITLLC--- 649
            ..|..|.|:.||.|..:.||:.:|........:...:.|..:.|...:|..   ::.:||:|   
Human   601 AVFEMFTPILGRSGSEIPPDVVLASILAGCTMILSSYFINFIYLAKSTKKT---MLTLTLVCAIT 662

  Fly   650 FIIAMTPIGFPY-----RPETNVQRFAVLHTKRTFHDAQNKVRRQESGYFIMPQDRRTYTVKNAV 709
            |::..:...|||     .|:.  :|..:.|..|||||.:....:::||.:|...|   ||   .:
Human   663 FLLVCSGTFFPYSSNPANPKP--KRVFLQHMTRTFHDLEGNAVKRDSGIWINGFD---YT---GI 719

  Fly   710 INMT-----LAQRIGSDCDKEIN-CGLPLYNQRWHKTRKNSLW-IPASEPVLGENVPTVLLLSKN 767
            .::|     :...|.:.|::... ||.|.|.......|||  | :||.| |...|.|...|:||.
Human   720 SHITPHIPEINDSIRAHCEENAPLCGFPWYLPVHFLIRKN--WYLPAPE-VSPRNPPHFRLISKE 781

  Fly   768 TVSPTKIRYEMQLSGPNHMALFIQPLNGAKMMDWSFHQAPLRLSFEPPYFIYFSWGVNGDPLKFW 832
            ......|:...:.:||:||:.:::...|:.:..||........|....||:::|.|:.....:||
Human   782 QTPWDSIKLTFEATGPSHMSFYVRAHKGSTLSQWSLGNGTPVTSKGGDYFVFYSHGLQASAWQFW 846

  Fly   833 LEL----EKPNGNWNSSTLELGLGGHWNHHKELITPDFKKFLDSFPHYVDATPWPASFESRIF 891
            :|:    |.|.|     .:.:.:..|:...::..:|......:.||.:...:.|..:::..:|
Human   847 IEVQVSEEHPEG-----MVTVAIAAHYLSGEDKRSPQLDALKEKFPDWTFPSAWVCTYDLFVF 904

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 136/309 (44%)
ERMP1NP_079172.2 M28_Fxna_like 104..412 CDD:193497 136/309 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368783164
eggNOG 1 0.900 E1_COG2234
Hieranoid 1 1.000
Homologene 1 1.000 H121891
Inparanoid 1 1.050 418 1.000 Inparanoid score I1789
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D152011at33208
OrthoFinder 1 1.000 FOG0000590
OrthoInspector 1 1.000 T608307
orthoMCL 1 0.900 OOG5_128724
Panther 1 1.100 O PTHR12147
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1738
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.