DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and Naalad2

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_006510685.1 Gene:Naalad2 MGIID:1919810 Length:846 Species:Mus musculus

Alignment Length:393 Identity:82/394 (21%)
Similarity:129/394 (33%) Gaps:125/394 (32%)


  Fly    77 RLP--RPLTIQDEETHPDQFIAERAEKNLREL-----------------VSLGPRVVGSRQNEMA 122
            |||  ..:.|.:...||..:  ..||:.||.|                 .::||...||..:   
Mouse   376 RLPVEEAVGIPNIPVHPIGY--NDAERLLRNLGGAAPPDKSWKGSLNVSYNIGPGFTGSEYS--- 435

  Fly   123 ALKMLSQKMQKIRSGTANDIEVDVQVASGSYVHWSMVNMYQSIQNIVVKISPKNTNSTTYLLVNS 187
                     :.||                  :|.:.:|....|.|::..|. .:|....|:::..
Mouse   436 ---------RNIR------------------MHVNNINKITRIYNVIGTIR-GSTEPDRYVILGG 472

  Fly   188 HYDSVPAG---PGAGDDGSMVATMMEVLRVLAK----SDKPLKNPVVFLFNGAEENPLQASHAFI 245
            |.||...|   |..|     .|.:.|:.|...|    ..:| :..::|....|||..|..|..:.
Mouse   473 HRDSWVFGGIDPTTG-----TAVLQEIARSFGKLVNGGWRP-RRTIIFASWDAEEFGLLGSTEWA 531

  Fly   246 TQHKWAKYCK----ALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQH-- 304
            .::  ||..:    |.||.||...|...:.....|....|:....|.|..|......:.|::.  
Mouse   532 EEN--AKLLQERSIAYINSDSAIEGNYTLRVDCTPLLNQLVYKVAREISSPDDGFESKSLYESWL 594

  Fly   305 --------------NFIPSDTDFRIFRDHGSVPGLDMAYT-------YNGF-VYHTRHDKAEIFP 347
                          |.:.|.:||..:.....:......||       |:.: ||||.::..|:. 
Mouse   595 EKDPSPENKECPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIYETFELV- 658

  Fly   348 RGSFQHTGDNLL-------ALVRQIANSPEIE-NSAKYAK---------------------GHTI 383
            :..:..|....|       |||.::|:|..|. |...|||                     .|.:
Mouse   659 QNFYDPTFKKQLSVAQLRGALVYELADSVVIPFNIQDYAKALKNYAASIFNISKKHDQQLRNHAV 723

  Fly   384 YFD 386
            .||
Mouse   724 SFD 726

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 77/378 (20%)
Naalad2XP_006510685.1 Zinc_peptidase_like 154..>210 CDD:301362
PA_GCPII_like 216..442 CDD:239036 18/98 (18%)
M28_PSMA_like 444..691 CDD:193568 57/257 (22%)
TFR_dimer 728..842 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.