DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and TFRC

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001121620.1 Gene:TFRC HGNCID:11763 Length:760 Species:Homo sapiens

Alignment Length:276 Identity:57/277 (21%)
Similarity:104/277 (38%) Gaps:68/277 (25%)


  Fly   160 NMYQSIQNIVVKISPKN--------TNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLA 216
            |:..::.|::.:|...|        .....|::|.:..|:  .||||...|...|.::::.::. 
Human   372 NVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDA--WGPGAAKSGVGTALLLKLAQMF- 433

  Fly   217 KSDKPLKN------PVVFLFNGAEENPLQASHAFITQHKWAKYCKAL--INLDSCGNGGREILFQ 273
             ||..||:      .::|....|.:.....:..::..:..:.:.||.  ||||....|.......
Human   434 -SDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLGTSNFKVS 497

  Fly   274 SGPNHPWLMKNYRRAIKHPYASTMGEELFQHNFIPSDTDFRIFRDHGSVPGL------------- 325
            :.|....|::...:.:|||   ..|:.|:|.:...|..: ::..|:.:.|.|             
Human   498 ASPLLYTLIEKTMQNVKHP---VTGQFLYQDSNWASKVE-KLTLDNAAFPFLAYSGIPAVSFCFC 558

  Fly   326 -DMAYTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEIENSAKYAKGHTIYFDVMG 389
             |..|.|.|                   .|.|....|:.:|   ||:...|:.|.      :|.|
Human   559 EDTDYPYLG-------------------TTMDTYKELIERI---PELNKVARAAA------EVAG 595

  Fly   390 WFLVFYTETEGVILNV 405
            .|::  ..|..|.||:
Human   596 QFVI--KLTHDVELNL 609

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 53/265 (20%)
TFRCNP_001121620.1 Mediates interaction with SH3BP4. {ECO:0000269|PubMed:16325581} 1..67
Endocytosis signal 20..23
Stop-transfer sequence 58..61
PA_TfR 201..377 CDD:239043 1/5 (20%)
M28_TfR 385..610 CDD:193572 54/264 (20%)
Ligand-binding 569..760 15/53 (28%)
TFR_dimer 642..750 CDD:282153
Cell attachment site, required for binding to transferrin 646..648
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.