DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and TFR2

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_003218.2 Gene:TFR2 HGNCID:11762 Length:801 Species:Homo sapiens

Alignment Length:283 Identity:49/284 (17%)
Similarity:102/284 (36%) Gaps:92/284 (32%)


  Fly   183 LLVNSHYDSVPA--------------------------GPGAGDDGSMVATMMEVLR----VLAK 217
            |:||:|..|.|.                          ||||.......|.::|::|    :::.
Human   399 LVVNNHRTSTPINNIFGCIEGRSEPDHYVVIGAQRDAWGPGAAKSAVGTAILLELVRTFSSMVSN 463

  Fly   218 SDKPLKNPVVFLFNGAEENPLQASHAFITQHKWAK------YCKAL--INLDSCGNGGREILFQS 274
            ..:|.::.:...::|.:...:.::       :|.:      :.||:  ::||:...|..:...::
Human   464 GFRPRRSLLFISWDGGDFGSVGST-------EWLEGYLSVLHLKAVVYVSLDNAVLGDDKFHAKT 521

  Fly   275 GPNHPWLMKNYRRAIKHPYASTMGEELFQH-------------NFIPSDTDFRIFRDHGSVPGLD 326
            .|....|:::..:.:..|..|  |:.|::.             ..:|.|:....|.....||.::
Human   522 SPLLTSLIESVLKQVDSPNHS--GQTLYEQVVFTNPSWDAEVIRPLPMDSSAYSFTAFVGVPAVE 584

  Fly   327 MAYTYNGFVY---HTRHDK-------------------AEIFPRGSFQHTGDNLLAL-------- 361
            .::..:...|   ||:.|.                   |::..:...:.:.|.||.|        
Human   585 FSFMEDDQAYPFLHTKEDTYENLHKVLQGRLPAVAQAVAQLAGQLLIRLSHDRLLPLDFGRYGDV 649

  Fly   362 -VRQIANSPEIENSAKYAKGHTI 383
             :|.|.|..|.....| |:|.|:
Human   650 VLRHIGNLNEFSGDLK-ARGLTL 671

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 49/284 (17%)
TFR2NP_003218.2 Endocytosis signal. {ECO:0000255} 23..26
PA_TfR 211..401 CDD:239043 1/2 (50%)
M28_TfR 409..642 CDD:193572 36/242 (15%)
TFR_dimer 674..787 CDD:309400
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.