DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and Tfrc

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_073203.1 Gene:Tfrc RGDID:70488 Length:761 Species:Rattus norvegicus

Alignment Length:616 Identity:118/617 (19%)
Similarity:202/617 (33%) Gaps:171/617 (28%)


  Fly    60 FGFWLLLYVTISIPACHRLPRPLTIQDEETHPDQFIA----ERAEKNLRELVSLGPR-------- 112
            ||...|.|...|:..        .:..:.:|.:..:|    |.|:.|::..|....|        
  Rat    13 FGGEPLSYTRFSLAR--------QVDGDNSHVEMKLAADEEENADSNMKASVRKPKRFNGRLCFA 69

  Fly   113 --------VVGSRQNEMAALKMLSQKMQKIRSGTANDIEVDVQ-----VASGSYVHWSMVN--MY 162
                    ::|.....:...|.:.||.:.:|...|.:.:....     |...|.:.|:.:.  :.
  Rat    70 TIAVVIFFLIGFMIGYLGYCKRVEQKEECVRLAEAEEADKSENDETEYVPKSSRLFWADLKTLLS 134

  Fly   163 QSIQNIVVKISPKNTNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAKSDK------- 220
            :.:.:|......|..:..||         .|...|:..|.:: |..:|.|....|..|       
  Rat   135 EKLNSIEFTDIIKQLSQNTY---------TPREAGSQKDENL-AYYIENLFHDFKFSKVWRDEHY 189

  Fly   221 ---PLKNPV----VFLFNGAEENPLQASHAFITQHKWAKYCKALINLDSCGNGGREILFQSGPNH 278
               .:||.|    |.:.:|:..:|::|...::...|..:....|::    .|.|.:..|:.    
  Rat   190 VKIQVKNSVSQNLVTINSGSNIDPVEAPEGYVAFSKAGEVTGKLVH----ANFGTKKDFEE---- 246

  Fly   279 PWLMKNYR--------RAIKHPYASTMGEELFQHNFIPSDTDFRIFRDHGSVPGLDMAYTYNGFV 335
                .||.        ||.|..:|..:..   ..:|  :.....|:.|..:.|.::....:.|  
  Rat   247 ----LNYSVNGSLVIVRAGKITFAEKVAN---AQSF--NAIGVLIYMDRNTFPVVEADLQFFG-- 300

  Fly   336 YHTRHDKAEIFPRG--SFQHT------GDNLLALVRQIANSPEIENSAKYAKGHTIYFDVMGWFL 392
             |......:.:..|  ||.||      ...|.::..|..:....|...|..:|:.    ...|  
  Rat   301 -HAHLGTGDPYTPGFPSFNHTQFPPSQSSGLPSIPVQTISRAAAEKLFKNMEGNC----PPSW-- 358

  Fly   393 VFYTETEGVILNVIVSLVSIGICGYAFKL-MSVNSGIKL--EKILKKVGHTLLVQILSVVVGAIL 454
                       |:..|      |    || :|.|..:||  ..:||:   |.::.|..|:.|...
  Rat   359 -----------NIDSS------C----KLELSQNQNVKLTVNNVLKE---TRILNIFGVIKGYEE 399

  Fly   455 P---VLLGLFMDAVHLPLSWFSNSW--------------LILGLYFTTFFFGLAIVPA---LYFH 499
            |   :::|...||           |              |.|...|:.........|:   ::..
  Rat   400 PDRYIVVGAQRDA-----------WGPGVAKSSVGTGLLLKLAQVFSDMISKDGFRPSRSIIFAS 453

  Fly   500 WTKRDKLPIGQRVQL---LLHCHCLLLSVLTLIFTICGIRSVFVLMLSCLFYT-VGLIIN----- 555
            ||..|...:|....|   |...|....:.:.|...:.| .|.|.:..|.|.|| :|.|:.     
  Rat   454 WTAGDYGAVGATEWLEGYLSSLHLKAFTYINLDKVVLG-TSNFKVSASPLLYTLMGKIMQDVKHP 517

  Fly   556 IATKLHTKDVAWV--IPHIVCTVPPFVFFAY 584
            |..|...:|..|:  |..:......|.|.||
  Rat   518 IDGKYLYRDSNWISKIEELSLDNAAFPFLAY 548

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 62/361 (17%)
TfrcNP_073203.1 PA_TfR 201..378 CDD:239043 41/224 (18%)
M28_TfR 386..611 CDD:193572 38/176 (22%)
TFR_dimer 643..751 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.