DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and naalad2

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001025553.1 Gene:naalad2 XenbaseID:XB-GENE-954117 Length:738 Species:Xenopus tropicalis

Alignment Length:357 Identity:79/358 (22%)
Similarity:125/358 (35%) Gaps:98/358 (27%)


  Fly   153 YVHWS--MVNMYQSIQNIVVKISPKNTNSTTYLLVNSHYDSVPAG---PGAGDDGSMVATMMEVL 212
            :||.:  :..:|..|..|...:.|..     |:::..|.||...|   |..|     .|.:.|:.
 Frog   333 HVHSNNEVTRIYDVIGTIRGAVEPDR-----YIILGGHRDSWVFGGIDPTTG-----AAVLQEIA 387

  Fly   213 RVLAKSDKPLKNP---VVFLFNGAEENPLQASHAFITQHKWA--------KYCKALINLDSCGNG 266
            |...|..:....|   ::|....|||..|..|      .:||        :...|.||.||...|
 Frog   388 RSFGKKVREGWRPRRTIIFASWDAEEFGLLGS------TEWAEENAKILNERAVAYINSDSAIEG 446

  Fly   267 GREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQH----------------NFIPSDTDFRI 315
            ...:.....|....|:.|..:.|..|.....||.|::.                |.:.|.:||..
 Frog   447 NYTLRVDCTPLMYRLVYNLTKEIASPDQGFEGESLYESWRQKDPSIENKEIPRINKLGSGSDFEA 511

  Fly   316 FRDHGSVPGLDMAYT-------YNGF-VYHTRHDKAEIFPR---GSF-------QHTGDNLLALV 362
            :.....:......||       |:.: ||||.::..|:..|   .||       |..|    :||
 Frog   512 YFQRLGIASARARYTKNRKTDKYSNYPVYHTVYETFELVERYYDPSFKKQLSVAQVRG----SLV 572

  Fly   363 RQIANSPEIE-NSAKYAKGHTIYFDVMGWFLVFYT---------ETEGVILNVIVSLVSIGICGY 417
            .::||:|.|. |...|.:.      :..:....|:         ||.||....:.|.:.      
 Frog   573 YELANAPVIPFNVQDYGEA------LKSYATSIYSLAKRNRSQMETYGVSFEPLFSAIQ------ 625

  Fly   418 AFKLMSVNSGIKLEKILKKVGH--TLLVQILS 447
              .....:.|  |.:.|:|:.|  .|.|:|::
 Frog   626 --NFTEASDG--LHQRLEKLDHHNPLAVRIMN 653

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 65/293 (22%)
naalad2NP_001025553.1 Zinc_peptidase_like 57..>103 CDD:326366
PA_GCPII_like 109..334 CDD:239036 0/1 (0%)
M28_PSMA_like 338..583 CDD:193568 61/265 (23%)
TFR_dimer 620..731 CDD:309400 9/45 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.