DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and Folh1

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_058050.3 Gene:Folh1 MGIID:1858193 Length:752 Species:Mus musculus

Alignment Length:324 Identity:69/325 (21%)
Similarity:116/325 (36%) Gaps:80/325 (25%)


  Fly   128 SQKMQKIRSGTA-------NDIEVDVQVASG-----------SYVH--WSMVNMYQSIQNIVVKI 172
            :||:.:...|.|       ..::|...|..|           .::|  ..:..:|..|..:...:
Mouse   304 AQKLLEHMGGPAPPDSSWKGGLKVPYNVGPGFAGNFSTQKVKMHIHSYTKVTRIYNVIGTLKGAL 368

  Fly   173 SPKNTNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLR---VLAKSDKPLKNPVVFLFNGAE 234
            .|..     |:::..|.|:...  |..|..|..|.:.|::|   .|.|..:..:..::|....||
Mouse   369 EPDR-----YVILGGHRDAWVF--GGIDPQSGAAVVHEIVRSFGTLKKKGRRPRRTILFASWDAE 426

  Fly   235 ENPLQAS------HAFITQHKWAKYCKALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPY 293
            |..|..|      |:.:.|.:...|    ||.||...|...:.....|....|:.|..:.::.|.
Mouse   427 EFGLLGSTEWAEEHSRLLQERGVAY----INADSSIEGNYTLRVDCTPLMYSLVYNLTKELQSPD 487

  Fly   294 ASTMGEELFQH--------NFI--------PSDTDFRIFRDHGSVPGLDMAYTYNGF-------- 334
            ....|:.|:..        .||        .|..||.:|.....:......||.|..        
Mouse   488 EGFEGKSLYDSWKEKSPSPEFIGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWKTNKVSSYP 552

  Fly   335 VYHTRHDKAEIF-----PRGSFQHTGDNLL-ALVRQIANS---P-EIENSA----KYAKGHTIY 384
            :||:.::..|:.     |...:..|...:. |:|.::|||   | :.::.|    |||  .|||
Mouse   553 LYHSVYETYELVVKFYDPTFKYHLTVAQVRGAMVFELANSIVLPFDCQSYAVALKKYA--DTIY 614

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 69/325 (21%)
Folh1NP_058050.3 Zinc_peptidase_like 70..>116 CDD:301362
PA_GCPII_like 122..348 CDD:239036 7/44 (16%)
NAALADase 276..589 58/296 (20%)
M28_PSMA_like 356..597 CDD:193568 54/252 (21%)
Substrate binding. {ECO:0000250|UniProtKB:Q9Y3Q0} 519..520 1/1 (100%)
Substrate binding. {ECO:0000250|UniProtKB:Q04609} 536..538 0/2 (0%)
Substrate binding. {ECO:0000250|UniProtKB:Q9Y3Q0} 554..555 1/1 (100%)
TFR_dimer 634..749 CDD:282153
Substrate binding. {ECO:0000250|UniProtKB:Q9Y3Q0} 701..702
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.