DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11961 and Folh1

DIOPT Version :9

Sequence 1:NP_001246418.1 Gene:CG11961 / 37221 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_058050.3 Gene:Folh1 / 53320 MGIID:1858193 Length:752 Species:Mus musculus


Alignment Length:324 Identity:69/324 - (21%)
Similarity:116/324 - (35%) Gaps:80/324 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 SQKMQKIRSGTA-------NDIEVDVQVASG-----------SYVH--WSMVNMYQSIQNIVVKI 172
            :||:.:...|.|       ..::|...|..|           .::|  ..:..:|..|..:...:
Mouse   304 AQKLLEHMGGPAPPDSSWKGGLKVPYNVGPGFAGNFSTQKVKMHIHSYTKVTRIYNVIGTLKGAL 368

  Fly   173 SPKNTNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLR---VLAKSDKPLKNPVVFLFNGAE 234
            .|..     |:::..|.|:...  |..|..|..|.:.|::|   .|.|..:..:..::|....||
Mouse   369 EPDR-----YVILGGHRDAWVF--GGIDPQSGAAVVHEIVRSFGTLKKKGRRPRRTILFASWDAE 426

  Fly   235 ENPLQAS------HAFITQHKWAKYCKALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPY 293
            |..|..|      |:.:.|.:...|    ||.||...|...:.....|....|:.|..:.::.|.
Mouse   427 EFGLLGSTEWAEEHSRLLQERGVAY----INADSSIEGNYTLRVDCTPLMYSLVYNLTKELQSPD 487

  Fly   294 ASTMGEELFQH--------NFI--------PSDTDFRIFRDHGSVPGLDMAYTYNGF-------- 334
            ....|:.|:..        .||        .|..||.:|.....:......||.|..        
Mouse   488 EGFEGKSLYDSWKEKSPSPEFIGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWKTNKVSSYP 552

  Fly   335 VYHTRHDKAEIF-----PRGSFQHTGDNLL-ALVRQIANS---P-EIENSA----KYAKGHTIY 384
            :||:.::..|:.     |...:..|...:. |:|.::|||   | :.::.|    |||  .|||
Mouse   553 LYHSVYETYELVVKFYDPTFKYHLTVAQVRGAMVFELANSIVLPFDCQSYAVALKKYA--DTIY 614

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 69/324 (21%)
Folh1NP_058050.3 Zinc_peptidase_like 70..>116 CDD:301362
PA_GCPII_like 122..348 CDD:239036 7/43 (16%)
NAALADase 276..589 58/295 (20%)
M28_PSMA_like 356..597 CDD:193568 53/251 (21%)