DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and Tfr2

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001276436.2 Gene:Tfr2 MGIID:1354956 Length:798 Species:Mus musculus

Alignment Length:628 Identity:129/629 (21%)
Similarity:197/629 (31%) Gaps:257/629 (41%)


  Fly    48 GNKIKWFWAPA---------------FFGFWLLLYVTISIPACHRLPRPLTIQDEETHPD----- 92
            |..|...||.|               |.|.:||.||... .:|......:.:.||:.:|:     
Mouse    65 GRSIPIPWAAAGRKAAPYLVLITLLIFTGAFLLGYVAFR-GSCQACGDSVLVVDEDVNPEDSGRT 128

  Fly    93 ------------QFIAE-RAEKNLRELVSLGPRVVGSRQNEMAAL------KMLSQKMQKIRSGT 138
                        :|:.| |.|..:| |.||..||.||.:  ||.|      |:..||:..:.:.|
Mouse   129 TLYWSDLQAMFLRFLGEGRMEDTIR-LTSLRERVAGSAR--MATLVQDILDKLSRQKLDHVWTDT 190

  Fly   139 ANDIEVDVQV---ASGSYVHWSMVNMYQSIQNIVVKISPK------NTNSTTYLLVNSHYDSVPA 194
            .   .|.:|.   |..:.:||  |:...|:|..:....|:      .|.:.|..||.:||     
Mouse   191 H---YVGLQFPDPAHANTLHW--VDADGSVQEQLPLEDPEVYCPYSATGNATGKLVYAHY----- 245

  Fly   195 GPGAGDD------------GSMVATMMEVL----RVLAKSDKPLKNPVVFL----FNGAEENPLQ 239
              |..:|            ||::...:.:.    :|....|...:..:::.    |:.....|..
Mouse   246 --GRSEDLQDLKAKGVELAGSLLLVRVGITSFAQKVAVAQDFGAQGVLIYPDPSDFSQDPHKPGL 308

  Fly   240 ASHAFITQHKWAKYCKALINLDSCGNG-------------------------------GREILFQ 273
            :||..:..|         ::|   |.|                               ..:|..|
Mouse   309 SSHQAVYGH---------VHL---GTGDPYTPGFPSFNQTQFPPVESSGLPSIPAQPISADIADQ 361

  Fly   274 -----SGPNHPWLMKNYRRAIKHPYASTMGEE--LFQHNFIPSDTDFRIFR--------DHGSV- 322
                 :||..|...|.:...  .||....|.:  |..:|...|.....||.        ||..| 
Mouse   362 LLRKLTGPVAPQEWKGHLSG--SPYRLGPGPDLRLVVNNHRVSTPISNIFACIEGFAEPDHYVVI 424

  Fly   323 --------PG-----------LDMAYTY-----NGFVYHTRHDKAEIF---PRGSFQHTGDNLLA 360
                    ||           |::..|:     |||    |..::.:|   ..|.|...|     
Mouse   425 GAQRDAWGPGAAKSAVGTAILLELVRTFSSMVSNGF----RPRRSLLFISWDGGDFGSVG----- 480

  Fly   361 LVRQIANSPEIENSAKYAKGHTIYFDVMGWFLVFYTETEGVILN----------VIVSLVSIGIC 415
                         :.::.:|   |..|:....|.|...:..:|.          ::|||:     
Mouse   481 -------------ATEWLEG---YLSVLHLKAVVYVSLDNSVLGDGKFHAKTSPLLVSLI----- 524

  Fly   416 GYAFKLMSVNSGIKLEKILKKV------GHTLLVQILSVVVGAILPVLLGLFMDAVHLPLSWFSN 474
                           |.|||:|      |.||..|:..........|:..|.||:     |.:| 
Mouse   525 ---------------ENILKQVDSPNHSGQTLYEQVALTHPSWDAEVIQPLPMDS-----SAYS- 568

  Fly   475 SWLILGLYFTTFFFGLAIVPALYFHWTKRDKLPIGQRVQLLLH 517
                    ||.|    |.|||:.|.:.:.|      ||...||
Mouse   569 --------FTAF----AGVPAVEFSFMEDD------RVYPFLH 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 82/431 (19%)
Tfr2NP_001276436.2 Endocytosis signal. {ECO:0000255} 23..26
PA_TfR 206..396 CDD:239043 36/213 (17%)
M28_TfR 404..637 CDD:193572 54/260 (21%)
TFR_dimer 669..784 CDD:309400
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.