DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and tfr1b

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001009918.2 Gene:tfr1b ZFINID:ZDB-GENE-041220-2 Length:771 Species:Danio rerio

Alignment Length:276 Identity:54/277 (19%)
Similarity:93/277 (34%) Gaps:106/277 (38%)


  Fly   597 FGRFGENLNPD---------LAV-----AVFSVAVGFL-------CCGFIIPVLQLFNKSKTIIC 640
            :.||.::.|||         |||     .:....:|.:       ..|...|:    ||.:.::|
Zfish    21 YSRFNQSQNPDGDGSRVEVKLAVDGEEEEMDGTELGNMQQETYTRSTGRSEPL----NKYRILVC 81

  Fly   641 GLMGITLLCFIIAMTPIGFPYRPETNVQRFAVLHTKRTFHDAQNKVRRQESGYFIMPQDRRTYTV 705
              :|..||.|::.:. ||:.            :|.|     :.||                    
Zfish    82 --VGAALLVFLVGLL-IGYS------------VHRK-----SDNK-------------------- 106

  Fly   706 KNAVINMTLAQRIGSDCDKEINCGLPLYNQRWHKTRKNSLWIPASEPVLGENVPT-----VLLLS 765
                     ::.:.:.|.|||....|              ..|..||:    ||:     ::.|.
Zfish   107 ---------SEPLETPCSKEIQAEEP--------------DPPQYEPI----VPSIDWSDIVKLL 144

  Fly   766 KNTVSPTKIRYEMQLSGPNHMALFIQPLNGAKMMDWSFHQAPLRLSFEP---PYFIYFSWGVNGD 827
            .:.:|...|  |.|||..:.:..........|:.| :.|.|..:|:.||   .:::......:.:
Zfish   145 NDKLSSKSI--EEQLSVYSQIGRSAGSSVDNKLGD-TIHDAFTKLNMEPWVDEHYVKLQNPDSSN 206

  Fly   828 PLKFWL---ELEKPNG 840
            |.|.|.   |:..|.|
Zfish   207 PNKVWFGNEEIGSPKG 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497
tfr1bNP_001009918.2 PA_TfR 209..383 CDD:239043 5/15 (33%)
M28_TfR 375..615 CDD:193572
TFR_dimer 653..761 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.