DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and Ermp1

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_006231303.1 Gene:Ermp1 RGDID:727831 Length:899 Species:Rattus norvegicus

Alignment Length:890 Identity:264/891 (30%)
Similarity:447/891 (50%) Gaps:59/891 (7%)


  Fly    27 RPRGSQQYEAQPNGCERAFVQGNKIKWFWAPAFFGFWLLLYVTISIPACHRLPRPLTIQDEETHP 91
            |.||..:...:..|.:.|.   ::.:...|.|.:...|...|.:|:... .|.|...:|.|    
  Rat    44 RMRGRTESGGESRGAKTAL---SEARTALALALYLLALRALVQLSLQRL-VLSRTSGLQGE---- 100

  Fly    92 DQFIAERAEKNLRELVSLGPRVVGSRQNEMAALKMLSQKMQKI--RSGTANDIEVDVQVASGSY- 153
              |.|.:|...|..:.::|||..||.:||:..::.|.:::..|  :|.:.:.|.||||..:||: 
  Rat   101 --FDARQARVYLEHITAIGPRTTGSAENEILTVQYLLEQITLIEEQSNSLHRISVDVQRPTGSFS 163

  Fly   154 --VHWSMVNMYQSIQNIVVKISPKNTNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLA 216
              ......:.|.:|.|:|||:.|:: .:...:|.|.|:|||...|||.||....|.|:|||||:|
  Rat   164 IDFLGGFTSYYDNITNVVVKLEPQD-GAKYAVLANCHFDSVANSPGASDDAVSCAVMLEVLRVMA 227

  Fly   217 KSDKPLKNPVVFLFNGAEENPLQASHAFITQHKWAKYCKALINLDSCGNGGREILFQSGPNHPWL 281
            .|.:||::.|||||||||||.|||||.|||||.||...:|.|||::.|.||:|::||:||.:|||
  Rat   228 ASPEPLQHAVVFLFNGAEENVLQASHGFITQHPWASLIRAFINLEAAGVGGKELVFQTGPENPWL 292

  Fly   282 MKNYRRAIKHPYASTMGEELFQHNFIPSDTDFRIFRDHGSVPGLDMAYTYNGFVYHTRHDKAEIF 346
            ::.|..|.|||:||.:.:|:||...|||||||||:||.|::||:|:|:..||::|||::|.|:..
  Rat   293 VQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRI 357

  Fly   347 PRGSFQHTGDNLLALVRQIANSPEIENSAKYAKGHTIYFDVMGWFLVFYTETEGVILNVIVSLVS 411
            ...|.|..|||:||:::.:|.|..:.:|::|..|..::|||:|..::.|....|.|:|.:|.:..
  Rat   358 LIDSIQRAGDNILAVLKYLATSDMLASSSEYRHGSMVFFDVLGLLVIAYPSRVGSIINYMVVMAV 422

  Fly   412 IGICGYAFKLMSVNSGIKLEKILKKVGHTLLVQILSVVVGAILPVLLGLFMDAVHLPLSWFSNSW 476
            :...|.........:...:...|..:|.|.:....|:|...|:.|    |:..:...|||::..:
  Rat   423 VLYLGRKLLRPKHRNSNYVRDFLCGLGITFISWFTSLVTVLIIAV----FVSLIGQSLSWYNYFY 483

  Fly   477 LILGLYFTTFFFGLAIVPAL--YFHWTKRDKLPIGQ---RVQLLLHCHCLLLSVLTLIFTICGIR 536
            :.:.||.|.....:.::..|  .|::.....|.:|:   ...|.:||..|      :..|..|..
  Rat   484 IAVCLYGTATVAKIILIHTLAKRFYYVNASDLYLGELFFDTSLFVHCGFL------VALTAQGFC 542

  Fly   537 SVFVLMLSCLFYTVGLIINIAT----KLHTKDVAWVIPHIVCTVPPFVFFAYFSHGFFTTFIPMF 597
            |.|   :|.::....|:..:..    |.|.....::..:::....|:::..|.....|..|.|:.
  Rat   543 SAF---MSAVWVAFPLLTKLCVYKDFKKHGAKGRFIALYLLGMFIPYLYGLYLIWAVFEMFTPIL 604

  Fly   598 GRFGENLNPDLAVAVFSVAVGFLCCGFIIPVLQLFNKSKTIICGLMGITLLCFIIAMTPIGFPY- 661
            ||.|..:.||:.:|........:...:.|..:.|.|.:|..|..|:.:..:.|::..:...||| 
  Rat   605 GRSGSEIPPDVVLASILAVCVMILSSYFITFIYLVNSTKKTILTLILVCAVTFLLVCSGAFFPYS 669

  Fly   662 -RPET-NVQRFAVLHTKRTFHDAQNKVRRQESGYFIMPQDRRTYTVKNAV------INMTLAQRI 718
             .|:: ..:|..:.|..||||:.:..|.:::||.:|...|   ||..:.|      ||.|    |
  Rat   670 SNPDSPKPKRVFLQHVSRTFHNLEGSVVKRDSGIWINGFD---YTGMSHVTPHIPEINDT----I 727

  Fly   719 GSDCDKEIN-CGLPLYNQRWHKTRKNSLW-IPASEPVLGENVPTVLLLSKNTVSPTKIRYEMQLS 781
            .:.|::... ||.|.|.......|||  | :||.| :...|.....|:||..:....|:...:.:
  Rat   728 RAHCEENAPLCGFPWYLPVHFLIRKN--WYLPAPE-ISPRNPAHFRLVSKEKMPWDSIKLTFEAT 789

  Fly   782 GPNHMALFIQPLNGAKMMDWSFHQAPLRLSFEPPYFIYFSWGVNGDPLKFWLELEKPNGNWNSST 846
            ||:||:.:::...|:.:..||........|....||:::|.|:.....:||:|:::.:.......
  Rat   790 GPSHMSFYVRTHKGSTLSQWSLGNGIPVTSRGGDYFVFYSHGLQASAWQFWIEVQQVSEEQPEGM 854

  Fly   847 LELGLGGHWNHHKELITPDFKKFLDSFPHYVDATPWPASFESRIF 891
            :.:.:..|:...:...:.......:.||.:...:.|.:::...:|
  Rat   855 VTVAIAAHYLSGENKRSSQLDALKEKFPDWSFPSAWVSTYSLFVF 899

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 137/309 (44%)
Ermp1XP_006231303.1 M28_Fxna_like 99..406 CDD:193497 138/314 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368785111
eggNOG 1 0.900 E1_COG2234
Hieranoid 1 1.000
Homologene 1 1.000 H121891
Inparanoid 1 1.050 416 1.000 Inparanoid score I1738
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D152011at33208
OrthoFinder 1 1.000 FOG0000590
OrthoInspector 1 1.000 T617252
orthoMCL 1 0.900 OOG5_128724
Panther 1 1.100 O PTHR12147
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.760

Return to query results.
Submit another query.