DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and CG10081

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_611418.1 Gene:CG10081 FlyBaseID:FBgn0034441 Length:875 Species:Drosophila melanogaster

Alignment Length:877 Identity:334/878 (38%)
Similarity:523/878 (60%) Gaps:32/878 (4%)


  Fly    30 GSQQYEAQPNGCERAFVQGNKIKWFWAPAFFGFWLLLYVTISIPACHRLPRPLTIQDEETHPDQF 94
            |.:.|..:.....|.:.|   :.|::|.....||.||::.:..|..:|||.|||::|  .....|
  Fly    16 GVKSYSRKHGRKHRVYFQ---LPWYFAGGIVLFWALLFIAVVKPLFYRLPEPLTVED--ASKGGF 75

  Fly    95 IAERAEKNLRELVSLGPRVVGSRQNEMAALKMLSQKMQKIRSGTANDI---EVDVQVASGSYVHW 156
            |||||:.||.:..::|.:||||.:||...::.|.:::..|:.....|:   |:|:|.|.|:||.|
  Fly    76 IAERAQANLYDFEAIGTKVVGSDENEHKTVQFLLKELNLIKDNIQEDLFDMEIDLQYAYGAYVKW 140

  Fly   157 SMVNMYQSIQNIVVKISPKNTNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAKSDKP 221
            ::|||||.|||:|||::||.|.|..|:|||||:||.|..|..||||.||.:::|||||::...|.
  Fly   141 NLVNMYQGIQNVVVKLTPKGTTSENYILVNSHFDSQPTSPSTGDDGHMVVSILEVLRVISSRRKS 205

  Fly   222 LKNPVVFLFNGAEENPLQASHAFITQHKWAKYCKALINLDSCGNGGREILFQSGPNHPWLMKNYR 286
            .::|::||.||:|||.|||||.||..|||||.|||:||||:.|:||||::||||||:|||:|.|:
  Fly   206 FEHPIIFLINGSEENSLQASHGFIAYHKWAKNCKAVINLDAAGSGGRELMFQSGPNNPWLVKIYK 270

  Fly   287 RAIKHPYASTMGEELFQHNFIPSDTDFRIFRDHGSVPGLDMAYTYNGFVYHTRHDKAEIFPRGSF 351
            ...||.:::||.||:||...:||.|||.||.::|::.|||:....|||||||::|:.::.||.:.
  Fly   271 DGAKHYFSTTMAEEIFQTGLVPSYTDFDIFVEYGNLIGLDIGQCINGFVYHTKYDRIDVIPRAAL 335

  Fly   352 QHTGDNLLALVRQIANSPEIENSAKYAKGHTIYFDVMGWFLVFYTETEGVILNVIVSLVSIGICG 416
            |:||||||.||:.::|:.|:.:.:....|:||:|||:|.:|:.|:...||.||..|:..:|.:..
  Fly   336 QNTGDNLLGLVQTLSNASELRDLSANPTGNTIFFDVLGLYLISYSADVGVKLNYAVAAAAIILIY 400

  Fly   417 YAFKLMSVNSGIKLEKILKKVGHTLLVQILSVVVGAILPVLLGLFMDAVHLPLSWFSNSWLILGL 481
            .:...::..|.:..|:||......|:||:::.|:...||:|:...:|...|.||:|:...|::||
  Fly   401 ISLLRIAEKSSVSSEQILSTFILVLVVQLIAFVLALALPLLVAYGLDKYGLSLSYFATPSLLIGL 465

  Fly   482 YFTTFFFGLAIVPALYFHWTKRDKLPIGQRVQLLLHCHCLLLSVLTLIFTICGIRSVFVLMLSCL 546
            |......||.:...:|......:|:...|:|||.||.|..:||:|.:.....|:|:.:|:..:..
  Fly   466 YICPSLLGLTLPSYIYLKLANTEKVSFAQQVQLALHGHAAVLSILCIAINYYGLRTTYVITWTLA 530

  Fly   547 FYTVGLIINIATKLHTKDVAWVIPHIVCTVPPFVFFAYFSHGFFTTFIPMFGRFGENLNPDLAVA 611
            ||.:.|..|:.|.||.:..:|.....:..|.||::.:|..:.|.....||.||||.:.||||.:.
  Fly   531 FYVIPLAFNLLTTLHDRGYSWTGILKIVQVAPFMYNSYLFYCFIVILTPMMGRFGVDTNPDLIIG 595

  Fly   612 VFSVAVGFLCCGFIIPVLQLFNKSKTIICGLMGITLL-CFIIAMTPIGFPYRPETNVQRFAVLHT 675
            ..:.....|..||:|.::.:..:|..::.||:.:|.. .:|.:.|.|||||||:|||||...|..
  Fly   596 ALTALGTILSMGFLILLVNMSRRSGFVLIGLLAVTAAGVYIASSTDIGFPYRPKTNVQRVPYLQV 660

  Fly   676 KRTFHDAQNKVRRQESGYFIMPQDRRTYTV-------KNAVINMTLAQRIGSDCDKEINCGLPLY 733
            :|.|::....|.:.||||....||||..|.       ...::|||      |||.|.:.||:|||
  Fly   661 RRIFYEYDGTVSKDESGYLFNLQDRRGLTPLLESNVDLTGLVNMT------SDCAKYMMCGMPLY 719

  Fly   734 NQRWHKTRKNSLWIPASEPVLGENVPTVLLLSKNTVSPTK-IRYEMQLSGPNHMALFIQPLNGAK 797
            :.||.:..:.::|:|...||.....|.:..|:|..::..: :::|.:|:..:|.::||.|.....
  Fly   720 DHRWVEAMETTMWLPRKNPVWTPAEPILKQLNKTVLADGQTVQFEFELTTSDHTSIFISPNEDVI 784

  Fly   798 MMDWSFHQAPLRLSFEPPYFIYFSWGVNGDPLKFWLELEKPNGNWNSSTLELGLGGHWNHHK--- 859
            :.:|||.:..|..: .|||.||:|:|::..||:|.:||:|.:|.:.....::|:|.|:.|.|   
  Fly   785 ISNWSFLKEYLTTN-SPPYHIYYSFGIDNTPLRFHIELKKADGVYTVPLFQMGIGAHYMHVKGDD 848

  Fly   860 ELITPDFKKFLDSFPHYVDATPWPASFESRIF 891
            |.|     :..:|.|.|..:..|||.::..||
  Fly   849 ESI-----RLANSLPDYAVSIQWPAMYKKYIF 875

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 154/307 (50%)
CG10081NP_611418.1 M28_Fxna_like 72..379 CDD:193497 154/307 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368256720
eggNOG 1 0.900 E1_COG2234
Homologene 1 1.000 H121891
Inparanoid 1 1.050 359 1.000 Inparanoid score I1280
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D152011at33208
OrthoFinder 1 1.000 FOG0000590
orthoMCL 1 0.900 OOG5_128724
Panther 1 1.100 P PTHR12147
RoundUp 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.