DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and CG10073

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001261090.1 Gene:CG10073 FlyBaseID:FBgn0034440 Length:881 Species:Drosophila melanogaster

Alignment Length:902 Identity:362/903 (40%)
Similarity:539/903 (60%) Gaps:43/903 (5%)


  Fly     8 VRRRVITPTNDPTN--VDPLLRPRGSQQYEAQPNGCERAFVQGNKIKWFWAPAFFGFWLLLYVTI 70
            ||.|..|..|..::  ::..:|...|::.:.|     ..:::|   .|:.|..|..||.||:..:
  Fly     5 VRSRFDTCKNKISDEPIEDAVRSASSKKIKNQ-----EQYLRG---PWYLATGFLLFWALLFSAV 61

  Fly    71 SIPACHRLPRPLTIQDEETHPDQFIAERAEKNLRELVSLGPRVVGSRQNEMAALKMLSQKMQKIR 135
            .:|..:|:|..|||:|  .....||||||:.||.:|..:|.:||||..||...:..|...:.:|:
  Fly    62 VLPLFYRIPTGLTIED--ASKGVFIAERAQSNLYKLAEIGTKVVGSDNNENKTVDYLMGLVNEIQ 124

  Fly   136 SGTAN---DIEVDVQVASGSYVHWSMVNMYQSIQNIVVKISPKNTNSTTYLLVNSHYDSVPAGPG 197
            ....:   |||||:|..||||:||:||||||.:||||:|:|||||.||||||||||:||.|..|.
  Fly   125 ENCLDDYFDIEVDLQEVSGSYIHWTMVNMYQGVQNIVIKLSPKNTTSTTYLLVNSHFDSKPTSPS 189

  Fly   198 AGDDGSMVATMMEVLRVLAKSDKPLKNPVVFLFNGAEENPLQASHAFITQHKWAKYCKALINLDS 262
            |||.|.||..::|||||:..:.:.:::|||||.||||||||||||.|||||||||.||.::|||:
  Fly   190 AGDAGQMVVAILEVLRVMCSTKQAIRHPVVFLLNGAEENPLQASHGFITQHKWAKNCKVVLNLDA 254

  Fly   263 CGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQHNFIPSDTDFRIFRDHGSVPGLDM 327
            .||||.:|:||:|||.|||::.|:....|..|:||.||:||...:||||||.||..:|::.||||
  Fly   255 AGNGGSDIVFQTGPNSPWLVEKYKENAPHYLATTMAEEIFQTGILPSDTDFAIFVKYGNLIGLDM 319

  Fly   328 AYTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEIENSAKYAKGHTIYFDVMGWFL 392
            |...|||.|||::|:....||||.|:||||||.|||.||||.|::|:..||.||.|:|||:|.:.
  Fly   320 AKFINGFAYHTKYDQFSNIPRGSIQNTGDNLLGLVRSIANSTELDNTEAYATGHAIFFDVLGLYF 384

  Fly   393 VFYTETEGVILNVIVSLVSIGICGYAFKLMSVNSGIKLEKILKKVGHTL-------LVQILSVVV 450
            :.|||:.|||||..|:.|::.:.     .:|:.....:.::  .:||.|       ::||::.|:
  Fly   385 ISYTESNGVILNYSVAGVALVLI-----FLSIWRTSSISRV--SIGHVLCWFILIFVLQIIAFVL 442

  Fly   451 GAILPVLLGLFMDAVHLPLSWFSNSWLILGLYFTTFFFGLAIVPALYFHWTKRDKLPIGQRVQLL 515
            |..||:::....|...|.:::||...|::|||......||::...:|....:.:|:...|.:||:
  Fly   443 GLGLPIVVAYVFDKYGLSITYFSTPVLLIGLYICPSLLGLSLPSYIYLKLQRSEKVGFAQHLQLV 507

  Fly   516 LHCHCLLLSVLTLIFTICGIRSVFVLMLSCLFYTVGLIINIATKLHTKDVAWVIPHIVCTVPPFV 580
            ||.|..:|::|.:..|:.|:||.:|...:.:||.:.|.:|:.|.||.:..:|.....:..|.||:
  Fly   508 LHGHAAVLAILDIGLTVYGLRSAYVPTWTLIFYVIPLAVNLLTTLHDRGFSWTGVLKIFQVVPFL 572

  Fly   581 FFAYFSHGFFTTFIPMFGRFGENLNPDLAVAVFSVAVGFLCCGFIIPVLQLFNKSKTIICGLMGI 645
            :.:|..:.|..|.|||.||||...||||.::........|..||:||::.:|.:...|:..|:.|
  Fly   573 YNSYLIYCFVVTLIPMMGRFGRATNPDLIISALCALGTILALGFVIPLVNMFRRPSLILLTLLAI 637

  Fly   646 T-LLCFIIAMTPIGFPYRPETNVQRFAVLHTKRTFHDAQNKVRRQESGYFIMPQDRR-TYTVKNA 708
            : :..:..:.|.|||||||:|||||...||.:|.|::....|.:.:|||....|||| ...:|.:
  Fly   638 SAVTIYTASSTQIGFPYRPKTNVQRLPYLHVRRIFYEYDGTVVKNDSGYLFNFQDRRGPAPLKLS 702

  Fly   709 VINMTLAQRIGSDCDKEINCGLPLYNQRWHKTRKNSLWIPASEPVLGENVPTVLLLSKNTVSPTK 773
            .:|.|....|.:|||..:.||.|||:.||.|.|...:|:|..|.::....|.:.||||..:....
  Fly   703 KLNTTGLVSIAADCDTVMMCGFPLYDHRWVKNRLQIMWLPREEEIITPYEPKLELLSKTELGNNT 767

  Fly   774 IRYEMQLSGPNHMALFIQPLNGAKMMDWSFHQAPLRLSF---EPPYFIYFSWGVNGDPLKFWLEL 835
            :|...|.:..:|.::|||||....:.:||     |..|:   :....:|||:|.|...|.|:::.
  Fly   768 LRMNFQSATTDHASVFIQPLEDVIISNWS-----LPTSYIGQQDTSHMYFSYGKNNTALTFFIDF 827

  Fly   836 EKPNGNWNSSTLELGLGGHWNHHK-ELITPDFKKFLDSFPHYVDATPWPASFESRIF 891
            .|.:.::.....::||..|:..:| :.|:.:|.|.:.||...||   ||||::..||
  Fly   828 YKLDADFAVPLCQIGLAVHFIGNKGDAISQEFAKKIPSFAAAVD---WPASYQRYIF 881

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 174/307 (57%)
CG10073NP_001261090.1 M28_Fxna_like 80..387 CDD:193497 174/307 (57%)
NrfD 398..638 CDD:304401 71/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368256573
eggNOG 1 0.900 E1_COG2234
Homologene 1 1.000 H121891
Inparanoid 1 1.050 359 1.000 Inparanoid score I1280
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D152011at33208
OrthoFinder 1 1.000 FOG0000590
orthoMCL 1 0.900 OOG5_128724
Panther 1 1.100 P PTHR12147
RoundUp 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.