DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and CG10062

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001261089.1 Gene:CG10062 FlyBaseID:FBgn0034439 Length:868 Species:Drosophila melanogaster

Alignment Length:861 Identity:418/862 (48%)
Similarity:586/862 (68%) Gaps:29/862 (3%)


  Fly    50 KIKWFWAPAFFGFWLLLYVTISIPACHRLPRPLTIQDEETHPDQFIAERAEKNLRELVSLGPRVV 114
            |::|::|||||||||:||:::.....:.:|||||..||.:||:.|||:|||..|.||..:|||||
  Fly    18 KLQWYYAPAFFGFWLVLYLSLVNTQMNHMPRPLTRSDEASHPNSFIAQRAEDTLIELTRIGPRVV 82

  Fly   115 GSRQNEMAALKMLSQKMQKIRSGTAN--DIEVDVQVASGSYVHWSMVNMYQSIQNIVVKISPKNT 177
            ||..||.:|::.|..::.|:.|..::  :||||||.|||:|:||.||||||.|||:|||:|.||:
  Fly    83 GSMANEESAVEFLRAEVAKVESEMSDLLEIEVDVQQASGAYMHWEMVNMYQGIQNVVVKLSEKNS 147

  Fly   178 NSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAKSDKPLKNPVVFLFNGAEENPLQASH 242
            .:..|||:||||||||..||||||||||.||:||:||:|||..||.:|:||||||||||||||||
  Fly   148 TNENYLLINSHYDSVPGSPGAGDDGSMVVTMLEVMRVIAKSGDPLAHPIVFLFNGAEENPLQASH 212

  Fly   243 AFITQHKWAKYCKALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQHNFI 307
            ||||||||||.|||||||||.|:||||||||||||||||| ||.|.:.||:|:|:.|||||..:|
  Fly   213 AFITQHKWAKNCKALINLDSAGSGGREILFQSGPNHPWLM-NYYRNVPHPFANTLAEELFQAGYI 276

  Fly   308 PSDTDFRIFRDHGSVPGLDMAYTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEIE 372
            |||||||||||:|.||||||||.:||:||||::::...|||.||||||||:|:|.|.:||:||::
  Fly   277 PSDTDFRIFRDYGGVPGLDMAYIFNGYVYHTKYNRINAFPRASFQHTGDNVLSLARALANAPELD 341

  Fly   373 NSAKYAKGHTIYFDVMGWFLVFYTETEGVILNVIVSLVSIGICGYAFKLMSVNSGIKLEKILKKV 437
            ::|.:::||.|::|.:|||::|||||..:|:||:|:|:::...|.:...||:.||...:.:|.:.
  Fly   342 DTAAHSEGHNIFYDFLGWFMIFYTETTSIIVNVVVTLLALLGVGISIYFMSLRSGCSWKGVLLRF 406

  Fly   438 GHTLLVQILSVVVGAILPVLLGLFMDAVHLPLSWFSNSWLILGLYFTTFFFGLAIVPALYFHWTK 502
            ..::.:|.:|:::...|.:|:.||||.|...:|||::||.|.|||.....|||:|:||||...||
  Fly   407 SISIAIQFVSLILAIGLALLVALFMDGVDRSMSWFTSSWTIFGLYLAPIVFGLSILPALYLEKTK 471

  Fly   503 RDKLPIGQRVQLLLHCHCLLLSVLTLIFTICGIRSVFVLMLSCLFYTVGLIINIATKLHTKDVAW 567
            ||.|.:|.|:||.:|.||:.|.|:.|..|...|||.:::||..||..|.||:|:.||.|.|...:
  Fly   472 RDPLGLGFRIQLFMHSHCICLIVIMLTLTGLSIRSAYLIMLCILFDIVALIVNLVTKWHRKAYLF 536

  Fly   568 VIPHIVCTVPPFVFFAYFSHGFFTTFIPMFGRFGENLNPDLAVAVFSVAVGFLCCGFIIPVLQLF 632
            .|...||.:.|.|||.|.......|.:||.||.|.:.|||:.:|........:..|||.|::..|
  Fly   537 AIAVTVCQILPLVFFTYLCTVALVTLMPMQGRSGSSTNPDMVIAALVWLFSLMFAGFIAPLIMFF 601

  Fly   633 NKSKTIICGLMGITLLCFIIAMTPIGFPYRPETNVQRFAVLHTKRTFHDAQNKVRRQESGYFIMP 697
            .|::||:...:|||:|..|||:|..||||:.:|:.||::::|..|..|:|....|..|||.:|.|
  Fly   602 RKTRTIVLCFLGITILFIIIAVTNAGFPYKEKTSPQRYSLIHAHRRLHNADGSTRIDESGLYIYP 666

  Fly   698 QDRRTYTVKNAVINMTLAQRIGSDCDKEINCGLPLYNQRWHKTRKNSLWIPASEPVLGENVPT-- 760
            ||||....|:.:..:..|.::...||:|:.||:||||.||:|.|:.|:||..||   ...:||  
  Fly   667 QDRRFGIAKDNIAAIGEAHQVSDFCDEEMFCGMPLYNHRWNKARQYSMWIETSE---SPEIPTEY 728

  Fly   761 ---VLLLSKNTVSPTKIRYEMQLSGPNHMALFIQPLNGAKMMDWSFHQAPLRLSFEPPYFIYFSW 822
               ||..|....:..:.|:...|:||:||.:||...|.|::::|||:...:|...||||.:|||:
  Fly   729 PMLVLQDSSELETSAQRRFNFTLAGPSHMGIFINVKNDARILNWSFNDTLIREQAEPPYMVYFSY 793

  Fly   823 GVNGDPLKFWLE------LEKPNGNWNSSTLELGLGGHWNHHKELITPD------FKKFLDSFPH 875
            |::..||:|.::      |:|....:::.|||:|:||||      :|.|      ...:::.||.
  Fly   794 GLDDSPLEFTIDVELNDYLQKTTSTFDTPTLEIGIGGHW------VTQDITAIEKLSSYINRFPS 852

  Fly   876 YVDATPWPASFESRIF 891
            |.....|..::|:..|
  Fly   853 YAYIQGWVGTYETWYF 868

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 202/306 (66%)
CG10062NP_001261089.1 M28_Fxna_like 59..364 CDD:193497 202/306 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368255986
eggNOG 1 0.900 E1_COG2234
Homologene 1 1.000 H121891
Inparanoid 1 1.050 219 1.000 Inparanoid score I1178
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D152011at33208
OrthoFinder 1 1.000 FOG0000590
orthoMCL 1 0.900 OOG5_128724
Panther 1 1.100 P PTHR12147
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1738
98.920

Return to query results.
Submit another query.