DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and CG13160

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001260918.1 Gene:CG13160 FlyBaseID:FBgn0033720 Length:875 Species:Drosophila melanogaster

Alignment Length:878 Identity:354/879 (40%)
Similarity:531/879 (60%) Gaps:39/879 (4%)


  Fly    39 NGCERAFVQGNKIK-------WFWAPAFFGFWLLLYVTISIPACHRLPRPLTIQDEETHPDQFIA 96
            :|.|...::.::.|       |::||.:..||:.|:..:..|....||..:.|.:|...|.||:|
  Fly    12 SGSENLIIEVDEDKIRCKQYSWYFAPIYLLFWVGLFFAVIYPLFQALPTGIKISEEADKPGQFVA 76

  Fly    97 ERAEKNLRELVSLGPRVVGSRQNEMAALKMLSQKMQKIRSGTANDI---EVDVQVASGSYVHWSM 158
            |||::.|.::..|||||||...||:..:.:|..:::|:|....:|:   ||:||.|||||:...:
  Fly    77 ERAQEILLQISRLGPRVVGDVDNEVTVVNLLLAEIEKVRQVLRDDVYEMEVEVQRASGSYLIKGL 141

  Fly   159 VNMYQSIQNIVVKISPKNTNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAKSDKPLK 223
            .|.||.:||::|::|.|::|||:|||||||||:.|..||||||.:||..|:||||::|.|..|..
  Fly   142 TNHYQGVQNVIVRLSTKSSNSTSYLLVNSHYDTKPGSPGAGDDAAMVVVMLEVLRLVAVSGDPFL 206

  Fly   224 NPVVFLFNGAEENPLQASHAFITQHKWAKYCKALINLDSCGNGGREILFQSGPNHPWLMKNYRRA 288
            :|::||||||||.|:|.||.|||||:||..||||:||||.|.|||::|||.||||||||::||.:
  Fly   207 HPIIFLFNGAEEQPMQGSHGFITQHRWAANCKALLNLDSAGAGGRDLLFQGGPNHPWLMEHYRNS 271

  Fly   289 IKHPYASTMGEELFQHNFIPSDTDFRIFRDHGSVPGLDMAYTYNGFVYHTRHDKAEIFPRGSFQH 353
            ..||:|:|..||:|:...||||||||||||.|.|||||||..||||||||:.|:..:....|.|:
  Fly   272 APHPFATTTAEEMFEAGIIPSDTDFRIFRDFGVVPGLDMAGVYNGFVYHTKFDRYAVISLDSLQN 336

  Fly   354 TGDNLLALVRQIANSPEIENSAKYAKGHTIYFDVMGWFLVFYTETEGVILNVIVSLVSIGICGYA 418
            :||||||||..|:|:.|:.::..:|.||.::||.:|.|.|.|.|:..:.||:..|..:|.:...:
  Fly   337 SGDNLLALVWSISNAEEMYDTEAHAAGHAVFFDFIGLFFVHYQESTSLALNLFFSFGAILLVCIS 401

  Fly   419 FKLMSVNSGIKLEKILKKVGHTLLVQILSVVVGAILPVLLGLFMDAVHLPLSWFSNSWLILGLYF 483
            ...||..:|..:.......|...|:.:...::....|:|:..|.|..:..|::||||||::|||.
  Fly   402 LWRMSRVTGQTMGTYAGVFGLLFLLALAGALLAVAFPLLMATFYDWGNRTLTYFSNSWLVIGLYI 466

  Fly   484 TTFFFGLAIVPALYFHWTKRDKLPIGQRVQLLLHCHCLLLSVLTLIFTICGIRSVFVLMLSCLFY 548
            .....||.:...||...||.:|:|....:.::.|.:|:||::|.|..|....||.::.::|.:||
  Fly   467 CPSVIGLVLPMTLYLTHTKCNKIPHTYYLHIVGHANCVLLAILCLGATALKYRSAYLFLISLIFY 531

  Fly   549 TVGLIINIATKLHTKDVAWVIPHIVCTVPPFVFFAYFSHGFFTTFIPMFGRFGENLNPDLAVAVF 613
            ...||||:.|:||.:...|.:..||..:.||::.||..|.|....|||.||||.:.|||:.:...
  Fly   532 VAALIINLLTRLHCRGYLWSLVLIVFQIIPFIYHAYLFHMFILILIPMTGRFGVSTNPDILIGAL 596

  Fly   614 SVAVGFLCCGFIIPVLQLFNKSKTIICGLMGITLLCFI---IAMTPIGFPYRPETNVQRFAVLHT 675
            ......|...|..|::.:|.:..   |.|.|:.|:.||   ||::.:||||||:|||.|...:..
  Fly   597 CGFGTILALSFAAPLINVFRRPN---CMLGGLALVMFIFCMIAVSDVGFPYRPKTNVMRADFMQV 658

  Fly   676 KRTFHDAQNKVRRQESGYFIMPQDRRTYTVKNAVINMTLAQRIGSDCDKEINCGLPLYNQRWHKT 740
            .|.|.:....:..::|||:....||.........:|:|...|:|.|||.|:.||:|.|  |:...
  Fly   659 HRKFFEYNGSISHEDSGYYFHLGDRNKEAPLRDHMNLTNLVRLGEDCDSELMCGIPCY--RYCSA 721

  Fly   741 RKNSLWIPASEPVLGENVPTVL-LLSKNTVS-PTKIRYEMQLSGPNHMALFIQPLNGAKMMDWSF 803
            |:::||:...||| ....|||| .|||..:| ..::|||.:|:||.:|.||.:||:|.|::.|:|
  Fly   722 REHALWLAREEPV-ELPYPTVLEFLSKTVLSGGYQVRYEFRLTGPPNMGLFFKPLDGVKLLRWTF 785

  Fly   804 HQAPLRL----SFEPPYFIYFSWGVNGDPLKFWLELEKPNGNWNSSTLELGLGGHWNHHKELITP 864
              ||..|    ::.||..:..::|::..|::|::||.|.:||:|....|:|:.||:      ::|
  Fly   786 --APAMLDNPATYRPPLEVMLTYGIDNTPIEFFVELSKDDGNFNEPVFEMGVSGHY------VSP 842

  Fly   865 DFKK------FLDSFPHYVDATPWPASFESRIF 891
            ..|:      ||.:.|.:..:..||:|:|..||
  Fly   843 HDKRDALSLEFLATLPDFAFSMEWPSSYERHIF 875

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 169/307 (55%)
CG13160NP_001260918.1 M28_Fxna_like 71..378 CDD:193497 169/307 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368256660
eggNOG 1 0.900 E1_COG2234
Homologene 1 1.000 H121891
Inparanoid 1 1.050 359 1.000 Inparanoid score I1280
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D152011at33208
OrthoFinder 1 1.000 FOG0000590
orthoMCL 1 0.900 OOG5_128724
Panther 1 1.100 P PTHR12147
RoundUp 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.