DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and CG33012

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_788335.2 Gene:CG33012 FlyBaseID:FBgn0053012 Length:912 Species:Drosophila melanogaster

Alignment Length:904 Identity:361/905 (40%)
Similarity:546/905 (60%) Gaps:34/905 (4%)


  Fly     4 SEKNVRRRV---ITPTNDPTNVDPLLRPRGSQQYEAQPNGCERAFVQGNKIKWFWAPAFFGFWLL 65
            ::||..:.|   |.|....:|| .|:..:...::..|             ::|:::||:..||:.
  Fly    27 NKKNTVQLVTDGIDPEEGCSNV-TLIELKQKSRFSKQ-------------LEWYYSPAYLLFWVG 77

  Fly    66 LYVTISIPACHRLPRPLTIQDEETHPDQFIAERAEKNLRELVSLGPRVVGSRQNEMAALKMLSQK 130
            |:..:..|..:.||..:.|::|...|..|:|:|||..|..|..:||::.|....|:..::.|..:
  Fly    78 LFFAVCYPLFNHLPTGVKIEEEANLPGTFVAQRAESILIRLDLMGPKIAGDYVTEVEMVEFLLGE 142

  Fly   131 MQKIRSGTANDI---EVDVQVASGSYVHWSMVNMYQSIQNIVVKISPKNTNSTTYLLVNSHYDSV 192
            :.|:|....||:   |||||.:|||::||.|:||||.|||:|||:|.|::|||:||||||||||.
  Fly   143 ISKVRDEMRNDLYDMEVDVQRSSGSFLHWQMINMYQGIQNVVVKLSSKSSNSTSYLLVNSHYDSK 207

  Fly   193 PAGPGAGDDGSMVATMMEVLRVLAKSDKPLKNPVVFLFNGAEENPLQASHAFITQHKWAKYCKAL 257
            |:..|.||...||.||:|.||::|.|::...:|:|||||||||.|...||:||:.|:|:..||||
  Fly   208 PSSVGTGDAELMVVTMLETLRLMATSEETFLHPIVFLFNGAEEQPFHGSHSFISNHRWSANCKAL 272

  Fly   258 INLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQHNFIPSDTDFRIFRDHGSV 322
            :||||.|.||||||||.|||||||||.|:::.|||:|:||.||:||.:.||||||||||||.|.|
  Fly   273 VNLDSAGAGGREILFQGGPNHPWLMKQYKKSAKHPFATTMAEEIFQADLIPSDTDFRIFRDFGPV 337

  Fly   323 PGLDMAYTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEIENSAKYAKGHTIYFDV 387
            ||||||..||||||||:.|:.::..||:.|:||||:|:|||.|:|:.|:.::..:::||:::||.
  Fly   338 PGLDMAGCYNGFVYHTKFDRYKVISRGALQNTGDNVLSLVRSISNAEEMYDTEAHSEGHSVFFDY 402

  Fly   388 MGWFLVFYTETEGVILNVIVSLVSI-GICGYAFKLMSVNSGIKLEKILKKVGHTLLVQILSVVVG 451
            :|.|.|:|||:.|..||:..||.:| .||...:::..|... :|....:..|...|:.||..::.
  Fly   403 LGLFFVYYTESTGTALNISFSLGAILVICLSLWRMAKVTDR-RLGTYARAFGMQFLLAILGFLLA 466

  Fly   452 AILPVLLGLFMDAVHLPLSWFSNSWLILGLYFTTFFFGLAIVPALYFHWTKRDKLPIGQRVQLLL 516
            ...|:|:.:|.||....:::||||||::||:......||.:...||......:|:|....:|::.
  Fly   467 LGFPLLMSVFYDAGDRTMTYFSNSWLVIGLFICPSIIGLVLPATLYLSLRPSEKIPHTYHLQIVG 531

  Fly   517 HCHCLLLSVLTLIFTICGIRSVFVLMLSCLFYTVGLIINIATKLHTKDVAWVIPHIVCTVPPFVF 581
            |.:|:.::||.::.|:.|||:.::.|:...||...||||:||:||.|...|.:...||.:.|:::
  Fly   532 HAYCVFMAVLCILLTVVGIRTAYLFMMCVFFYLGALIINLATRLHDKGYLWALVLCVCQILPYLY 596

  Fly   582 FAYFSHGFFTTFIPMFGRFGENLNPDLAVAVFSVAVGFLCCGFIIPVLQLFNKSKTIICGLMGIT 646
            |.|..|......|||..|.|.:.||||.:::.......|...|:.|:|.||.:.|.:|.||   |
  Fly   597 FTYLFHALLVITIPMTSRKGMDANPDLLISLECALGSILAMVFLAPLLNLFRRPKAMIGGL---T 658

  Fly   647 LLCFI---IAMTPIGFPYRPETNVQRFAVLHTKRTFHDAQNKVRRQESGYFIMPQDRRTYTVKNA 708
            |:.||   |:::.:||||||.|||.|...|...|.|::....:..::|||:...||||.......
  Fly   659 LVMFIFCMISVSDVGFPYRPTTNVMRLHFLEVHRKFYEFDGSISLEDSGYYFDLQDRRFENPLLD 723

  Fly   709 VINMTLAQRIGSDCDKEINCGLPLYNQRWHKTRKNSLWIPASEPVLGENVPTVLLLSKNTV---- 769
            .||:|...|:...|..|:.||||.:|.||.....::.|:|..|||.....|.:..|:|..:    
  Fly   724 KINLTGITRVDDYCKTEMYCGLPCFNHRWCSAVNDARWLPRDEPVDLPGTPILQFLNKTVLGTES 788

  Fly   770 SPTKIRYEMQLSGPNHMALFIQPLNGAKMMDWSFHQAPL--RLSFEPPYFIYFSWGVNGDPLKFW 832
            :|..:.|.:..|||..|:.|:||.:|.:|:.|||.:..|  ...::|||.|:|.:|.:..|::|:
  Fly   789 APRALYYFVVSSGPPRMSFFVQPRDGVRMLSWSFLKGMLDNPSVYKPPYHIFFGYGSDDSPVEFY 853

  Fly   833 LELEKPNGNWNSSTLELGLGGHWNHHKELITPDFKKFLDSFPHYVDATPWPASFESRIF 891
            .|:.|.:||::...:|||:.||:..|........:||::..|.:.....||.|:|..||
  Fly   854 FEMTKDDGNFDGPVVELGISGHYMSHLSKRDATTQKFIEDLPDFAHPMEWPTSYERYIF 912

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 170/307 (55%)
CG33012NP_788335.2 M28_Fxna_like 103..410 CDD:193497 170/307 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368256602
eggNOG 1 0.900 E1_COG2234
Homologene 1 1.000 H121891
Inparanoid 1 1.050 359 1.000 Inparanoid score I1280
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D152011at33208
OrthoFinder 1 1.000 FOG0000590
orthoMCL 1 0.900 OOG5_128724
Panther 1 1.100 P PTHR12147
RoundUp 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.