DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and gcp-2.3

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001024446.1 Gene:gcp-2.3 WormBaseID:WBGene00044121 Length:700 Species:Caenorhabditis elegans

Alignment Length:460 Identity:97/461 (21%)
Similarity:151/461 (33%) Gaps:159/461 (34%)


  Fly    74 ACHRLPRPLTIQDEETHPDQFIA----------------ERAEKNLRELVSLGPRVVGSRQN--- 119
            ||.....|:.:....|.|.:|..                .|.:|.....|.   ||||.:::   
 Worm   213 ACLLYSDPMQVASLGTGPSEFFKIIQANFNPFFVIDSTYGRTDKMPSHAVQ---RVVGWKKDPNY 274

  Fly   120 -----EMAALKMLSQKMQ----------------KIRSGTANDIEVDVQVASGSYVHWSMVNMYQ 163
                 ..:|.::|.:||:                :...|..|:.::.|.|.:        .|..:
 Worm   275 SLLPIPYSAAQILFEKMKGDAVIADFQGKLDVTYRYGPGLINNQKLRVTVHA--------KNEER 331

  Fly   164 SIQNIVVKISPKNTNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAKSDKPLKN---- 224
            .|||::..|. .:.....::||.:|||:...  ||.|..|:.:|::||.|.|    |..:|    
 Worm   332 KIQNVLGYIK-GSQEPDKFVLVGNHYDAWTY--GAVDPNSVTSTLLEVTRAL----KAYQNLTGW 389

  Fly   225 -PVVF-------------LFN--GAEENPLQASHAFITQHK--WAKYCKALINLDSCGNGGREIL 271
             ||.|             ||.  .|||..|..|..|..:|:  ..:...|.||.|..| |.:.:|
 Worm   390 RPVTFTLVLKMGFLTRSILFAHWDAEEYGLIGSTEFAEEHRTQLMRRAVAYINTDMIG-GNQSLL 453

  Fly   272 FQSGPNHPWLMKNYRRAIKHPYASTMGEELFQHNFIPSDT-----DFRIFRDHGSVPGLDM-AYT 330
            ..:.|....:::.....|.||...|         |:|..|     .|..|:....:..|.: .:.
 Worm   454 AMANPTVVNVLRAAAAKISHPNPKT---------FLPHKTIIPHIHFTSFQQVAVIICLSLIIWV 509

  Fly   331 YNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEIENSAKYAKGHTIYFDVMGWFLVFY 395
            :..|.....|..|.:|                              ....||||           
 Worm   510 FRWFSLSHHHWTARLF------------------------------IPSYHTIY----------- 533

  Fly   396 TETEGVILNVIVSLVSIGICGYAFKLMSVNSGIKLEKILKKVGHTLLVQILSVVVGAILPVLLGL 460
             ||..:|.|::                  :...|:.|.:   |..|:..||:.....|||..|..
 Worm   534 -ETPYLIDNIL------------------DPEYKMHKAM---GEMLIECILNFSESRILPYDLKE 576

  Fly   461 FMDAV 465
            .||.|
 Worm   577 LMDRV 581

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 76/372 (20%)
gcp-2.3NP_001024446.1 Zinc_peptidase_like 49..>103 CDD:301362
Peptidases_S8_S53 109..324 CDD:299169 20/114 (18%)
Zinc_peptidase_like 332..572 CDD:301362 71/320 (22%)
TFR_dimer <615..695 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.