DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and Naalad2

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001100272.1 Gene:Naalad2 RGDID:1305872 Length:778 Species:Rattus norvegicus

Alignment Length:367 Identity:80/368 (22%)
Similarity:123/368 (33%) Gaps:108/368 (29%)


  Fly    77 RLP--RPLTIQDEETHPDQFIAERAEKNLREL-----------------VSLGPRVVGSRQNEMA 122
            |||  ..:.|.:...||..:  ..||:.||.|                 .::||...||..:   
  Rat   308 RLPVEEAVGIPNIPVHPIGY--NDAERLLRNLGGTAPPDQSWKGSLNVSYNIGPGFSGSEYS--- 367

  Fly   123 ALKMLSQKMQKIRSGTANDIEVDVQVASGSYVHWSMVNMYQSIQNIVVKISPKNTNSTTYLLVNS 187
                     :|:|                  :|...:|....|.|::..|. .:|....|:::..
  Rat   368 ---------RKVR------------------MHVHNINKITRIYNVIGTIR-GSTEPDRYVILGG 404

  Fly   188 HYDSVPAG---PGAGDDGSMVATMMEVLRVLAK----SDKPLKNPVVFLFNGAEENPLQAS---- 241
            |.||...|   |..|     .|.:.|:.|...|    ..|| :..::|....|||..|..|    
  Rat   405 HRDSWVFGGIDPTTG-----TAVLQEIARSFGKLVNGGWKP-RRTIIFASWDAEEFGLLGSTEWA 463

  Fly   242 --HAFITQHKWAKYCKALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQH 304
              :|.|.|.:...|    ||.||...|...:.....|....|:....|.|..|......:.|::.
  Rat   464 EENAKILQERSIAY----INSDSAIEGNYTLRVDCTPLLHQLVYKVAREISSPDDGFESKSLYES 524

  Fly   305 ----------------NFIPSDTDFRIFRDHGSVPGLDMAYT-------YNGF-VYHTRHDKAEI 345
                            |.:.|.:||..:.....:......||       |:.: ||||.::..|:
  Rat   525 WLEKDPSPENKERPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIYETFEL 589

  Fly   346 FPRGSFQHTGDNLL-------ALVRQIANSPEIE-NSAKYAK 379
            . :..:..|....|       |||.::|:...|. |...|||
  Rat   590 V-QNFYDPTFKKQLSVAQLRGALVYELADCVVIPFNIQDYAK 630

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 75/352 (21%)
Naalad2NP_001100272.1 Zinc_peptidase_like 86..>142 CDD:301362
PA_GCPII_like 148..374 CDD:239036 18/98 (18%)
M28_PSMA_like 376..623 CDD:193568 58/259 (22%)
TFR_dimer 660..774 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.