DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and Tfr2

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_006249178.1 Gene:Tfr2 RGDID:1310152 Length:838 Species:Rattus norvegicus

Alignment Length:286 Identity:61/287 (21%)
Similarity:102/287 (36%) Gaps:98/287 (34%)


  Fly   183 LLVNSHYDSVPA--------------------------GPGAGDDGSMVATMMEVLR----VLAK 217
            |:||:|..|.|.                          ||||.......|.::|::|    :::.
  Rat   434 LVVNNHRTSTPISNIFACIEGFAEPDHYVVIGAQRDAWGPGAAKSAVGTAILLELVRTFSSMVSS 498

  Fly   218 SDKPLKNPVVFLFNGAEENPLQASHAFITQHKWAK------YCKAL--INLDS--CGNGG----- 267
            ..:|.::.:...::|.:...:.|:       :|.:      :.||:  ::||:  .|:|.     
  Rat   499 GFRPRRSLLFISWDGGDFGSVGAT-------EWLEGYLSVLHLKAVVYVSLDNSVLGDGKFHAKT 556

  Fly   268 --------REILFQ-SGPNHPWLMKNYRRAIKHPYASTMGEELFQHNFIPSDTDFRIFRDHGSVP 323
                    ..||.| ..|||.......:.|..||   :...|:.|.  :|.|:....|.....||
  Rat   557 SPLLVSLIENILKQVDSPNHSGQTLYDQVAFTHP---SWDAEVIQP--LPMDSSAYSFTAFAGVP 616

  Fly   324 GLDMAYTYNGFVY---HTRHDKAEIFP---RGSF--------QHTG--------DNLLAL----- 361
            .::.::..:..||   ||:.|..|...   ||..        |..|        |:||.|     
  Rat   617 AVEFSFMEDDRVYPFLHTKEDTYENLHKMLRGRLPAVVLAVAQLAGQLLIRLSHDHLLPLDFGRY 681

  Fly   362 ----VRQIANSPEIENSAKYAKGHTI 383
                :|.|.|..|.....| |:|.|:
  Rat   682 GDVVLRHIGNLNEFSGDLK-ARGLTL 706

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 61/287 (21%)
Tfr2XP_006249178.1 PA_TfR 246..436 CDD:239043 1/2 (50%)
M28_TfR 444..677 CDD:193572 48/245 (20%)
TFR_dimer 709..828 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.