DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and SPCC1919.12c

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_588494.1 Gene:SPCC1919.12c PomBaseID:SPCC1919.12c Length:843 Species:Schizosaccharomyces pombe

Alignment Length:709 Identity:170/710 (24%)
Similarity:285/710 (40%) Gaps:158/710 (22%)


  Fly    41 CERAFVQGNKIKWFWAPAFFGFWLLLYV-TISIPACHRLPRPLTIQDEETHPDQFIAERAEKNLR 104
            |.:||...      ...:.|||.:||.: .:......::|.|..::|.|       .:||..:|.
pombe    13 CAKAFQSS------LTCSIFGFTVLLILYLLDWKRIAQVPGPNLLKDLE-------FQRAWNDLE 64

  Fly   105 ELVSLGPRVVGSRQNE---------MAALKMLSQKMQKIRSGTANDIEVDVQVASGSYVHWSMVN 160
            .:.|| |....|:|||         |..|:..:|....:...|..:|..:           |..|
pombe    65 YISSL-PHPYNSKQNEHVRSYILKSMRELEATNQSYITVIDDTLTNITFE-----------STDN 117

  Fly   161 ---MYQSIQNIVVKISPKNTNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAKSDKPL 222
               .|....||:||...|:.:... :|:::|:|||..|.||.|||..|||:|.:.|..|| ::|.
pombe   118 DTLTYFEGDNILVKFEGKSKDLFP-ILLSAHFDSVSTGYGATDDGMGVATVMAIARYYAK-NQPN 180

  Fly   223 KNPVVFLFNGAEENPLQASHAFITQHKWAKYCKALINLDSCGNGGREILFQSGPNHPWLMKNYRR 287
            ::.::.: |.|||:.|..:.|| ..||.:|...|.:||:..|:||:.:||:|...|  :...|.:
pombe   181 RDLIINI-NNAEEDYLFGAKAF-ASHKLSKNVTAFVNLEGAGSGGKAMLFRSSNGH--VSSAYFK 241

  Fly   288 AIKHPYASTMGEELFQHNFIPSDTDFRIF-RDHGSVPGLDMAYTYNGFVYHTRHDKAEIFPRGSF 351
            ...:|.||.:|.:.|:...|.|.||:.:: :.|....|||:|:..|..:||||.|........|.
pombe   242 GNHYPLASILGNDFFKRGVIRSQTDYIVYEKMHNHTAGLDIAFYENRDIYHTRKDDINHLMPSSL 306

  Fly   352 QH---TGDNLLALVRQIANSPEIENSAKYAKGHTIYFDVMGWF----LVFYTETEGVILNVIVSL 409
            :|   |..|   .|:.:.|..: .:..|:.|  .::|...|.:    |..|.     :||:|.::
pombe   307 RHMMYTASN---AVKNLLNDSK-SDLTKFRK--PMFFLAFGKYWQLNLPIYQ-----VLNIIFAV 360

  Fly   410 VSIGICGYAFKLMSVNSGIKLEKILKKVGHTL--LVQILSVVVGAILPVLLGLFMDAVHLPLSWF 472
                ||.....|..:......|: |||..:|:  :|..:.|.:...|.|||          |:|.
pombe   361 ----ICPIVLLLTLIRFPSLYEQ-LKKPRYTVCFVVSCIFVSIFDTLTVLL----------LTWI 410

  Fly   473 ------SNSWLILGLYFTTFFFGLAI---VPALYFHWTKRDKLPI-------GQRVQLLLHCHCL 521
                  |::.|||.|::.|....||.   ..|.:...:..|...|       .|.:..|:....:
pombe   411 NPYVINSHTGLILALFYLTNLIALAFSFRAAATHSKLSSEDLSSIEIVFIWYAQILWYLVFIVSV 475

  Fly   522 LLSVLTLIFTICGIRSVFVLMLSCLFYT-----------------------VGLIIN-------- 555
            :||:...:.:...:...::...:|...|                       :|..||        
pombe   476 ILSIYFQLGSTYWVTLSYLCTFTCCIMTIIRINYFVDNVVTTQTTHEEDALIGSSINTSSHQHYG 540

  Fly   556 --------------IATKLHTK--DVAWVIPHIVCTVPPFVFFAYFSHGFFTTFIPMFGR----- 599
                          ::.:.|.|  |..|.:.:.:..||..||..|  .....|.:|...:     
pombe   541 STLNSTPHRRNSIALSNRAHVKLIDNIWTVIYFIFNVPFPVFLCY--DILVETILPAGSQTLTDS 603

  Fly   600 -FGENLNPDLAVAVFSVAVGFLCCG-FIIPVLQLFNKSKTIICGLMGITLLCFIIAMTP 656
             |...|   ..:.:|.|.:..:..| ||...|   :|....:..::.|||....:::.|
pombe   604 VFSSKL---YKLVIFVVFLSLVNSGPFIFRAL---SKKSLAVLTMLWITLFVQALSVNP 656

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 94/324 (29%)
SPCC1919.12cNP_588494.1 Iap 35..511 CDD:225143 135/527 (26%)
M28_Fxna_like 51..343 CDD:193497 95/323 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000590
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12147
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1738
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.