DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and SPCC1259.02c

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001342785.1 Gene:SPCC1259.02c PomBaseID:SPCC1259.02c Length:822 Species:Schizosaccharomyces pombe

Alignment Length:836 Identity:214/837 (26%)
Similarity:353/837 (42%) Gaps:182/837 (22%)


  Fly    76 HRLPRPLTIQDEETHPDQFIAERAEKNLRELV-SLGPRVVGSRQNEMAALKMLSQKM---QKIRS 136
            :.|..||....:.....||....|.|::..|. .:|.|::|:.:.|.|...::::.:   ::::.
pombe    37 NHLDEPLVDPYDANGNPQFSEANALKHVIHLSDDIGYRILGTIEQERAREYIMNEVLALQKQLQD 101

  Fly   137 GTANDI-EVDVQVASG------SYVHWSMVNMYQSIQNIVVKISPKNTNST-----TYLLVNSHY 189
            |...|| :::|.:.||      .:::..::..||:::||||::|    |.|     ..:|:|:|.
pombe   102 GPNADIHQMEVSLESGDGAHRFDFMNKYVIKKYQNLKNIVVRLS----NGTEACKEEAVLINAHV 162

  Fly   190 DSVPAGPGAGDDGSMVATMMEVLRVLAKSDKPLKNPVVFLFNGAEENPLQASHAFITQHKWAKYC 254
            ||....|||.||...||.::|.:|:......||.:.:|||||.|||:...|||.||||.......
pombe   163 DSTLPSPGATDDALAVAILLEAIRIFISRPVPLTHSIVFLFNDAEESLQDASHMFITQSPLRDTI 227

  Fly   255 KALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQHNFIPSDTDFRIFRDH 319
            |.::||::||..|.|||||:..|.  ::|.|.. :.||:.:.:.:::|:...|.||||||.|..:
pombe   228 KCVVNLEACGTTGSEILFQATSNE--MIKAYSH-VPHPFGTVLADDVFRTGLILSDTDFRQFVQY 289

  Fly   320 GSVPGLDMAYTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEIENSAKYAKGHTIY 384
            |::.|||||...|.::|||:.|.|.....|:.|:.|:|:||::..:. |||.:.:...:.| |:|
pombe   290 GNLTGLDMAVVKNSYLYHTKKDLAPYISPGTPQNFGENILAILTYLV-SPEADLNNMKSSG-TVY 352

  Fly   385 FDVMGWFLVFYTETEGVILNVIVSLVSIGICGYAFKLMSVNSGIKLEKILKKVGHTLLVQILSV- 448
            |.|.......|::....|||.:|     |..|....|........:         .|:.|::|: 
pombe   353 FSVFNSLFFMYSKLTSKILNTLV-----GGLGILLTLRGSEGSFTV---------ALIAQVISIA 403

  Fly   449 ---VVGAILPVLLGLFMDAVHLPLSWFSNSWLILGLYFTTFFFGLAIVPALYFHWTKRDKLPIGQ 510
               |:..|...:||..:|.   .:|||.|.:..|.:|....|..|....:|:    ||.:     
pombe   404 GIFVIPNIWAYILGNVLDC---GMSWFRNEYWPLFIYLPAIFASLFFTESLF----KRSE----- 456

  Fly   511 RVQLLLHCHCLLLSVLTLI-------FTICGIRSVFVLMLSCLFYTVGLIINIATKLHTKDVAWV 568
              .|.|.....:.|:||.|       |||.....||.|.|:             .|:..|.    
pombe   457 --HLALRATIFIFSLLTFIPLPSAYLFTIIDFFMVFALFLN-------------DKILAKP---- 502

  Fly   569 IPHIVCTVPPFVFF----AYFSHGF------FTTFIPMFGRFGENLNPDLAVAVFSVAVGFLCCG 623
                 .||.|..:|    ...:.||      ...|:|:.||.|.:...|..||...|      ||
pombe   503 -----GTVHPLTYFIGSIGAMTVGFESAINLLEIFVPLTGRIGTDKVADNVVATVCV------CG 556

  Fly   624 FII------PVLQLFNKSKTIICGLMGITLLCFIIAMTPIGFPYRPETNVQRFAVLHTKRTFHDA 682
            |.|      |.:|.|   ::..|..:|:....|::..:..              :|..:.|::|:
pombe   557 FNIYFPLMSPWIQRF---RSRCCFRLGLLFSIFVVGFSSF--------------ILAKQDTYYDS 604

  Fly   683 QNKVRRQESGYFIMPQDRRTYTVKNAVINMTLA------QRIGSDC------DKEINCGLPLYNQ 735
            .:..|       |..|.....|.....:::..|      .::.||.      :..:...:..:|.
pombe   605 LHPRR-------IFVQRMENITSNEVSLHIASADSAPGFDKLSSDLSSLLTDEPVVKTEMDDWNS 662

  Fly   736 RWHKTRK-----NSLWIPASEPVLGENVPTVLLLSK----NTVSPTKIRYEMQLSGPNHMALFIQ 791
            .|.....     .|..||.::.|....:|::...:|    |.|:.| :..|       |..|...
pombe   663 DWDTVYPFSQFLGSYRIPLNDTVDVTTLPSIKFSNKVVKDNVVNVT-VTVE-------HPGLIWT 719

  Fly   792 PLN-GAKMMDWSFHQAPLRL----------------SFEPPYF---IYFSW-GVNG 826
            .:: .|.::.||..:.|..:                ||...|.   |||.: ||:|
pombe   720 VVSFDADVLSWSLPEVPSTVRRHHVREVSAYGLDSYSFNMSYLEAPIYFDFVGVDG 775

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 107/320 (33%)
SPCC1259.02cNP_001342785.1 M28_Fxna_like 52..363 CDD:193497 107/320 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H121891
Inparanoid 1 1.050 234 1.000 Inparanoid score I830
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000590
OrthoInspector 1 1.000 T631337
orthoMCL 1 0.900 OOG5_128724
Panther 1 1.100 O PTHR12147
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1738
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.