DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and CG30049

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_725142.3 Gene:CG30049 FlyBaseID:FBgn0050049 Length:878 Species:Drosophila melanogaster

Alignment Length:858 Identity:344/859 (40%)
Similarity:531/859 (62%) Gaps:25/859 (3%)


  Fly    50 KIKWFWAPAFFGFWLLLYVTISIPACHRLPRPLTIQDEETHPDQFIAERAEKNLRELVSLGPRVV 114
            ::.|::||:|...|:.|:..|.:|..:|||..:|:.||...|.||:.|||:|.|.||..:||:||
  Fly    30 RLPWYYAPSFLLLWVALFYAIVLPLFYRLPDRVTMADEPLKPGQFVGERAQKILYELDRIGPKVV 94

  Fly   115 GSRQNEMAALKMLSQKMQKIRSGTAND---IEVDVQVASGSYVHWSMVNMYQSIQNIVVKISPKN 176
            ||..||:..:..|..:::||||....|   :|||||..:||||..:|.::||.|||:|||:|..:
  Fly    95 GSTANEVTTVAFLLNEVEKIRSEMRGDLFHLEVDVQQPTGSYVVGTMTSIYQGIQNVVVKLSTAS 159

  Fly   177 TNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAKSDKPLKNPVVFLFNGAEENPLQAS 241
            :||::|||:|||:|:.|..|||||||:||..|:||||.::.|:....:|:|||||||||||||||
  Fly   160 SNSSSYLLINSHFDTKPGSPGAGDDGTMVVVMLEVLRQMSISESEFMHPIVFLFNGAEENPLQAS 224

  Fly   242 HAFITQHKWAKYCKALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQHNF 306
            |.||||||||..|||:|||:..|||||:||||||||:|||:|.|::..|||:|||:.||:||...
  Fly   225 HGFITQHKWAPNCKAVINLEVGGNGGRDILFQSGPNNPWLVKYYKQHSKHPFASTLAEEIFQFGI 289

  Fly   307 IPSDTDFRIFRDHGSVPGLDMAYTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEI 371
            :|||||||||||:|::||||:|...||:||||..|..::.|..:.|:||:|:|:|||.::|:.|:
  Fly   290 LPSDTDFRIFRDYGNIPGLDIAQFSNGYVYHTAFDSFDVVPGRAVQNTGENILSLVRALSNASEL 354

  Fly   372 ENSAKYAKGHTIYFDVMGWFLVFYTETEGVILNVIVSLVSIGICGYAFKLMSVNSGIKLEKILKK 436
            .|:.:::.||.::||.:|.|.|.|||..|:|||...::.|:.:.|::...||..|.:...:|...
  Fly   355 YNTNEHSAGHAVFFDFLGLFFVTYTENTGIILNYCFAVASVFLVGFSLWRMSCVSEVSAGRISIL 419

  Fly   437 VGHTLLVQILSVVVGAILPVLLGLFMDAVHLPLSWFSNSWLILGLYFTTFFFGLAIVPALYFHWT 501
            ....|.:.:...::...||:::.:..|.....::::||:||::|||......||.:...||..:.
  Fly   420 FASHLGLHLAGCLLCIGLPLVMSILYDVSDRTMTYYSNNWLVIGLYICPAIIGLVLPSTLYHSFK 484

  Fly   502 KRDKLPIGQRVQLLLHCHCLLLSVLTLIFTICGIRSVFVLMLSCLFYTVGLIINIATKLHTKDVA 566
            ..||:....::.:.||.||::||:||:..|..|:|..::.|:|...|.:.|:||:.|.||.:...
  Fly   485 SDDKISHPYQMYVGLHAHCVVLSILTIALTAIGLRIPYMCMISLFLYILSLLINLLTTLHDRGYY 549

  Fly   567 WVIPHIVCTVPPFVFFAYFSHGFFTTFIPMFGRFGENLNPDLAVAVFSVAVGFLCCGFIIPVLQL 631
            ||:...:..:..:|:|.|..:.|...|.|..||..::.|||:.:|:......|...||::|::.:
  Fly   550 WVLTVQISQLFQYVYFCYLFYIFLVIFFPAMGRNRDSANPDMLIALICAVGTFFALGFVVPLINM 614

  Fly   632 FNKSKTIICGLMGITLLCFIIAMTPIGFPYRPETNVQRFAVLHTKRTFHDAQNKVRRQESGYFIM 696
            |..|..::..|..:|.:..:|::|.:||||||:|:|.|...|.|:|.|::....:...:|||:..
  Fly   615 FRWSTYLLICLGVVTFILSMISITGVGFPYRPKTSVMRVNFLQTRRMFYEYDGSLSVNDSGYYFD 679

  Fly   697 PQDRRTY-TVKNAVINMTLAQRIGSDCDKEINCGLPLYNQRWHKTRKNSLWIPASEPVLGENVPT 760
            .||||.. .:|:..:|:|....:...||:.:.||:|.:...|.:...::.|:|..|.|   .||.
  Fly   680 YQDRRALRPLKDYAVNLTGLTSVDGYCDRYVMCGIPCFWSSWCRGISSAAWLPRDEEV---TVPG 741

  Fly   761 VL---LLSKN-TVSPTKIRYEMQLSGPNHMALFIQPLNGAKMMDWSFHQAPLRL--SFEPPYFIY 819
            .|   .|:|. :.|.:..|:|.:|:||.||.|:|:||:|..:.||||.:..|..  .:.|||.||
  Fly   742 NLELNFLNKTLSKSGSSARFEFELAGPPHMGLYIRPLDGVAVEDWSFIRTMLDQPEKYSPPYQIY 806

  Fly   820 FSWGVNGDPLKFWLELEKPNGNWNSSTLELGLGGHWNHHKELITPDFK------KFLDSFPHYVD 878
            ||:||:..|.||.:|..|.:|..:....|||:.||:      :..||:      :|:...|.:|.
  Fly   807 FSYGVDSSPFKFHIEFVKSDGQLDGPIFELGVVGHY------VNQDFERDETTLRFIADLPDFVY 865

  Fly   879 ATPWPASFESRIF 891
            ...||:.|...||
  Fly   866 TMEWPSLFMRYIF 878

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 170/307 (55%)
CG30049NP_725142.3 M28_Fxna_like 71..378 CDD:193497 170/307 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368256629
eggNOG 1 0.900 E1_COG2234
Homologene 1 1.000 H121891
Inparanoid 1 1.050 359 1.000 Inparanoid score I1280
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D152011at33208
OrthoFinder 1 1.000 FOG0000590
orthoMCL 1 0.900 OOG5_128724
Panther 1 1.100 P PTHR12147
RoundUp 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.