DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and CG30047

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_725141.1 Gene:CG30047 FlyBaseID:FBgn0050047 Length:879 Species:Drosophila melanogaster

Alignment Length:856 Identity:352/857 (41%)
Similarity:542/857 (63%) Gaps:19/857 (2%)


  Fly    49 NKIKWFWAPAFFGFWLLLYVTISIPACHRLPRPLTIQDEETHPDQFIAERAEKNLRELVSLGPRV 113
            :::.|::||:|...|:.|:..:..|..||||..:.|..|.:.|.||:||||::.|.:...:||:|
  Fly    30 HRLPWYYAPSFLLLWVALFYAVVYPLYHRLPDSVLISHESSKPGQFVAERAQRLLYKYDKIGPKV 94

  Fly   114 VGSRQNEMAALKMLSQKMQKIRSGTAND---IEVDVQVASGSYVHWSMVNMYQSIQNIVVKISPK 175
            |||..||:..:..|.::::.||:...:|   :::|||..||:|:||.||||||.:.|:|||||.:
  Fly    95 VGSVANEVTTVAFLEEEVENIRAAMRSDLYELQLDVQHPSGAYMHWQMVNMYQGVTNVVVKISSR 159

  Fly   176 NTNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAKSDKPLKNPVVFLFNGAEENPLQA 240
            ::||::|||||||:||.|:.||:||||:||..|:||||.:|.||.|.::|:||||||||||||:|
  Fly   160 SSNSSSYLLVNSHFDSKPSSPGSGDDGTMVVVMLEVLRQVAISDTPFEHPIVFLFNGAEENPLEA 224

  Fly   241 SHAFITQHKWAKYCKALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQHN 305
            ||.||||||||..|||||||:..|:|||::|||||||:|||:|.|.:..|||:|:||.||:||..
  Fly   225 SHGFITQHKWAGNCKALINLEVAGSGGRDLLFQSGPNNPWLIKYYYQNAKHPFATTMAEEIFQSG 289

  Fly   306 FIPSDTDFRIFRDHGSVPGLDMAYTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPE 370
            .:|||||||||||:|.:||||||...||:||||..|..:..|..|.|.:|||.|:|||..|::||
  Fly   290 ILPSDTDFRIFRDYGQLPGLDMAQISNGYVYHTIFDNVQAVPIDSLQSSGDNALSLVRAFADAPE 354

  Fly   371 IENSAKYAKGHTIYFDVMGWFLVFYTETEGVILNVIVSLVSIGICGYAFKLMSVNSGIKLEKILK 435
            ::|...:::||.::||.:|.|.|:|||..|::||..:::.|:.:...:...|...|.:.:.::..
  Fly   355 MQNPEDHSEGHAVFFDYLGLFFVYYTENTGIVLNCCIAVASLVLVVCSLLRMGRESDVSIGRVSI 419

  Fly   436 KVGHTLLVQILSVVVGAILPVLLGLFMDAVHLPLSWFSNSWLILGLYFTTFFFGLAIVPALYFHW 500
            .....|::.:|.:::...||:|:.:..||....:::|||:||::||:......|..:...||:..
  Fly   420 WFAIILVLHVLGMILSLGLPLLMAVLFDAGDRSMTYFSNNWLVIGLFIVPAIIGQILPLTLYYTL 484

  Fly   501 TKRDKLPIGQRVQLLLHCHCLLLSVLTLIFTICGIRSVFVLMLSCLFYTVGLIINIATKLHTKDV 565
            ...|::.....:.:.||.||:|||::.:|.|...:|:.::.|:|.|||...|:||:.:.||.:..
  Fly   485 KPNDEISHPNHIHMSLHAHCVLLSLIAIILTAISLRTPYLCMMSLLFYGGALLINLLSTLHDRGY 549

  Fly   566 AWVIPHIVCTVPPFVFFAYFSHGFFTTFIPMFGRFGENLNPDLAVAVFSVAVGFLCCGFIIPVLQ 630
            .||:...|..:.||::|.|..:.|...|.||.||||...||||.:|:......|...||:.|::.
  Fly   550 YWVVLVQVLQLVPFLYFCYLFYTFLLVFFPMLGRFGHGTNPDLLIALICAVGTFFALGFVAPLIN 614

  Fly   631 LFNKSKTIICGLMGITLLCFIIAMTPIGFPYRPETNVQRFAVLHTKRTFHDAQNKVRRQESGYFI 695
            :|...|..:.||..:|.:..:||::.:|||||.:|:|.|...||.:|.|::....|...:|||:.
  Fly   615 IFRWPKLALLGLGVVTFIFSMIAVSEVGFPYRAKTSVMRIHFLHVRRIFYEYDGSVSLSDSGYYF 679

  Fly   696 MPQDRRT-YTVKNAVINMTLAQRIGSDCDKEINCGLPLYNQRWHKTRKNSLWIPASEPVLGENVP 759
            ..||||. |.::|..:|:|......|:|||.:.||:|.:|.||.|||..|.|:|..:.|......
  Fly   680 DFQDRRLYYPLENTSVNLTGLASTSSECDKYLMCGVPCFNHRWCKTRAKSHWLPREQEVAIPGAT 744

  Fly   760 TVLLLSKNTVSPTKI-RYEMQLSGPNHMALFIQPLNGAKMMDWSFHQAPLRL--SFEPPYFIYFS 821
            ::.||||..:...|: |:|.::|||.||:|:||||:|.::.||||.:..|..  ::.|||.|:|:
  Fly   745 SLKLLSKAVLDSGKVARFEFEISGPPHMSLYIQPLDGVEVEDWSFIRNMLDEPDTYSPPYQIFFA 809

  Fly   822 WGVNGDPLKFWLELEKPNGNWNSSTLELGLGGHWNHHKELITPDFK------KFLDSFPHYVDAT 880
            :|.:..||||.::..|.:|::::.|.:||...      ..::.|:.      ||:..||.:....
  Fly   810 YGADNTPLKFHIDFAKSSGDFSTPTFQLGFAA------SFVSYDYDRDAAGLKFISDFPDFAHVM 868

  Fly   881 PWPASFESRIF 891
            .||..:|..||
  Fly   869 EWPTLYERYIF 879

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 172/307 (56%)
CG30047NP_725141.1 M28_Fxna_like 72..379 CDD:193497 172/307 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368256696
eggNOG 1 0.900 E1_COG2234
Homologene 1 1.000 H121891
Inparanoid 1 1.050 359 1.000 Inparanoid score I1280
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D152011at33208
OrthoFinder 1 1.000 FOG0000590
orthoMCL 1 0.900 OOG5_128724
Panther 1 1.100 P PTHR12147
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1738
98.920

Return to query results.
Submit another query.