DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and CG30043

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_725143.1 Gene:CG30043 FlyBaseID:FBgn0050043 Length:878 Species:Drosophila melanogaster

Alignment Length:864 Identity:358/865 (41%)
Similarity:539/865 (62%) Gaps:23/865 (3%)


  Fly    43 RAFVQGNKIKWFWAPAFFGFWLLLYVTISIPACHRLPRPLTIQDEETHPDQFIAERAEKNLRELV 107
            :.:|:..::.|::||:|...||.|:..|.||..:|||..|||.:|...|.:|:||||::.|....
  Fly    23 KGYVRRPRLSWYYAPSFLLLWLALFYAIVIPLYYRLPDRLTISEESHRPGEFVAERAQQYLYTYD 87

  Fly   108 SLGPRVVGSRQNEMAALKMLSQKMQKIRSGTAN---DIEVDVQVASGSYVHWSMVNMYQSIQNIV 169
            .:||:|.||..||:..::.|..:.:|||:...:   |:|:|||..:|.||...||||||.|.|::
  Fly    88 RIGPKVTGSYANEVTTVEFLVNETEKIRAEMRSDLYDLELDVQSPTGGYVFNDMVNMYQGIHNVI 152

  Fly   170 VKISPKNTNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAKSDKPLKNPVVFLFNGAE 234
            ||:|.|::.|.:|||:|||:||.|..||:||||:||..||||||.::.|:.|.::|:||||||||
  Fly   153 VKLSSKSSQSESYLLLNSHFDSKPGSPGSGDDGTMVVVMMEVLRQMSISEIPFEHPIVFLFNGAE 217

  Fly   235 ENPLQASHAFITQHKWAKYCKALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGE 299
            ||||||||.||||||||:.|||.|||:..|:|||::|||||||:|||||.||:..|||:|:||.|
  Fly   218 ENPLQASHGFITQHKWAEKCKAFINLEVGGSGGRDLLFQSGPNNPWLMKYYRQHAKHPFATTMAE 282

  Fly   300 ELFQHNFIPSDTDFRIFRDHGSVPGLDMAYTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQ 364
            |:||...:|||:|||||||:|::.|||:|...||:||||..|..|..|..|.|::|:|:|||||.
  Fly   283 EIFQSGVLPSDSDFRIFRDYGNIAGLDIAQIENGYVYHTAFDTYENVPGRSIQNSGNNVLALVRA 347

  Fly   365 IANSPEIENSAKYAKGHTIYFDVMGWFLVFYTETEGVILNVIVSLVSIGICGYAFKLMSVNSGIK 429
            .:|:.|:.|: :....|.::||.:|.|.|:||||.|:::|.::.::|:.:.|.:...|...|.  
  Fly   348 YSNASELYNT-ESDDSHAVFFDFLGLFFVYYTETTGIVVNCVIGVLSLVLVGCSVWRMCHQSE-- 409

  Fly   430 LEKILKKVGHTLLVQILSV----VVGAI----LPVLLGLFMDAVHLPLSWFSNSWLILGLYFTTF 486
             |..|.::.    :..||:    |||.:    ||:|:.:..||....|::|:::||:.|||....
  Fly   410 -EASLPQIS----IWFLSILGLHVVGFLLCICLPLLMAVLFDAGDRSLTYFTSNWLVFGLYVCPA 469

  Fly   487 FFGLAIVPALYFHWTKRDKLPIGQRVQLLLHCHCLLLSVLTLIFTICGIRSVFVLMLSCLFYTVG 551
            ..||.:...||:.....:||....::||.||.|.::.::|.||.|..|:||.::.::|.:||...
  Fly   470 IIGLVLPLTLYYTLLPNEKLSQAYQLQLSLHAHLVVQALLALILTAMGLRSQYLCLISMIFYGGA 534

  Fly   552 LIINIATKLHTKDVAWVIPHIVCTVPPFVFFAYFSHGFFTTFIPMFGRFGENLNPDLAVAVFSVA 616
            |:||:.:.||.:...||...:...|.||.:|.|..:.|...|||:.||.|.:.||||.|.:....
  Fly   535 LLINLVSTLHDRGYYWVPIVMFLQVLPFSYFCYLFYMFLVIFIPVLGRNGYSTNPDLIVGLLCGV 599

  Fly   617 VGFLCCGFIIPVLQLFNKSKTIICGLMGITLLCFIIAMTPIGFPYRPETNVQRFAVLHTKRTFHD 681
            ..|...||...::.:|...|.|:.||..:|.:..:||::.:|||||.:|||.|...|||:|.|::
  Fly   600 CVFFALGFAAQLINMFRWPKLILLGLGVMTFIFCMIAVSDVGFPYRAKTNVMRANCLHTRRIFYE 664

  Fly   682 AQNKVRRQESGYFIMPQDRRTYT-VKNAVINMTLAQRIGSDCDKEINCGLPLYNQRWHKTRKNSL 745
            ....|.|.:|||:...||||.:. ::::.:::|..:.:.:.||..:.||:|.:...|.|.|:...
  Fly   665 HDGSVSRSDSGYYFNYQDRRAFAPLEDSALDLTGLEPVANRCDDYVMCGIPCFYYSWCKWRQWDG 729

  Fly   746 WIPASEPVLGENVPTVLLLSKNTV-SPTKIRYEMQLSGPNHMALFIQPLNGAKMMDWSFHQAPL- 808
            |:|....|:.....|:..|....: |.|..|||.:|:||.||.|||||:..||:.||||.:..| 
  Fly   730 WLPRESEVILPGELTLDFLGYTVLESGTVARYEFELAGPPHMNLFIQPVGSAKVDDWSFVRKMLD 794

  Fly   809 -RLSFEPPYFIYFSWGVNGDPLKFWLELEKPNGNWNSSTLELGLGGHWNHHKELITPDFKKFLDS 872
             ...|:|||.|:.|:|.:...|||::::|||:|.:::.||||...|||...:.....:.|.|:.:
  Fly   795 EPEEFQPPYQIFHSYGTDNTSLKFFIDMEKPDGIFDTPTLELAAVGHWVSFEYERDAEAKDFVAA 859

  Fly   873 FPHYVDATPWPASFESRIF 891
            ||.:|....||:.|:..||
  Fly   860 FPDFVHVMEWPSIFKRYIF 878

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 165/307 (54%)
CG30043NP_725143.1 M28_Fxna_like 71..377 CDD:193497 165/307 (54%)
PMT_2 493..>634 CDD:304453 48/141 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368256744
eggNOG 1 0.900 E1_COG2234
Homologene 1 1.000 H121891
Inparanoid 1 1.050 359 1.000 Inparanoid score I1280
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D152011at33208
OrthoFinder 1 1.000 FOG0000590
orthoMCL 1 0.900 OOG5_128724
Panther 1 1.100 P PTHR12147
RoundUp 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.