DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and Ermp1

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001349060.1 Gene:Ermp1 MGIID:106250 Length:899 Species:Mus musculus

Alignment Length:829 Identity:256/830 (31%)
Similarity:429/830 (52%) Gaps:59/830 (7%)


  Fly    93 QFIAERAEKNLRELVSLGPRVVGSRQNEMAALKMLSQKMQKI--RSGTANDIEVDVQVASGSY-- 153
            :|.|.:|...|..:.::|||..||.:||:..::.|.::::.|  :|.:.:.|.||:|..:||:  
Mouse   100 EFDARQARDYLEHITAIGPRTTGSTENEILTVQYLLEQIKLIEAQSNSLHSISVDIQRPTGSFSI 164

  Fly   154 -VHWSMVNMYQSIQNIVVKISPKNTNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAK 217
             ......:.|.:|.|:|||:.|:: .:.:.:|.|.|:|||...|||.||....|.|:|||||::.
Mouse   165 DFLGGFTSYYDNITNVVVKLEPRD-GAESAILANCHFDSVANSPGASDDAVSCAVMLEVLRVMSA 228

  Fly   218 SDKPLKNPVVFLFNGAEENPLQASHAFITQHKWAKYCKALINLDSCGNGGREILFQSGPNHPWLM 282
            |.:|:::.|||||||||||.|||||.|||||.||...:|.|||::.|.||:|::||:||.:|||:
Mouse   229 SPEPMQHAVVFLFNGAEENVLQASHGFITQHPWASLIRAFINLEAAGVGGKELVFQTGPENPWLV 293

  Fly   283 KNYRRAIKHPYASTMGEELFQHNFIPSDTDFRIFRDHGSVPGLDMAYTYNGFVYHTRHDKAEIFP 347
            :.|..|.|||:||.:.:|:||...|||||||||:||.|::||:|:|:..||::|||::|.|:...
Mouse   294 QAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRIL 358

  Fly   348 RGSFQHTGDNLLALVRQIANSPEIENSAKYAKGHTIYFDVMGWFLVFYTETEGVILNVIVSLVSI 412
            ..|.|..|||:||:::.:|.|..:.:|::|..|..::|||:|..::.|....|.|:|.:|.:..:
Mouse   359 IDSIQRAGDNILAVLKHLATSDTLASSSEYRHGSMVFFDVLGLLVIAYPSRVGSIINYMVVMAVV 423

  Fly   413 GICGYAFKLMSVNSGIKLEKILKKVGHTLLVQILSVVVGAILPVLLGLFMDAVHLPLSWFSNSWL 477
            ...|.........:...:...|..:|.|.:....|:|...|:.|    |:..:...|||::..::
Mouse   424 LYLGKKLLRPKHRNANYMRDFLCGLGITFISWFTSLVTVLIIAV----FISLIGQSLSWYNYFYI 484

  Fly   478 ILGLYFTTFFFGLAIVPAL--YFHWTKRDKLPIGQ---RVQLLLHCHCLLLSVLTLIFTICGIRS 537
            .:.||.|.....:..:..|  .|::.....|.:|:   ...|.:||..|      :..|..|..|
Mouse   485 AVCLYGTATVAKIIFIHTLAKRFYYMNASDLYLGELFFDTSLFVHCAFL------VALTYQGFCS 543

  Fly   538 VFVLMLSCLFYTVGLIINIAT----KLHTKDVAWVIPHIVCTVPPFVFFAYFSHGFFTTFIPMFG 598
            .|   :|.::....|:..:..    |.|.....:|..:::....|:::..|.....|..|.|:.|
Mouse   544 AF---MSAVWVVFPLLTKLCVYKDFKKHGAQGRFVALYLLGMFIPYLYGLYLIWAVFEMFTPILG 605

  Fly   599 RFGENLNPDLAVAVFSVAVGFLCCGFIIPVLQLFNKSKTIICGLMGITLLCFIIAMTPIGFPY-- 661
            |.|..:.||:.:|........:...:.|..:.|.|.:|..|..|:.:..:.|::..:...|||  
Mouse   606 RSGSEIPPDVVLASILAVCVMILSSYFITFIYLVNSTKKTILTLILVCAVTFLLVCSGAFFPYSS 670

  Fly   662 RPET-NVQRFAVLHTKRTFHDAQNKVRRQESGYFIMPQDRRTYTVKNAV------INMTLAQRIG 719
            .||: ..:|..:.|..||||:.:..|.:::||.:|...|   ||..:.|      ||.|    |.
Mouse   671 NPESPKPKRVFLQHVSRTFHNLEGSVVKRDSGIWINGFD---YTGMSHVTPHIPEINDT----IR 728

  Fly   720 SDCDKEIN-CGLPLYNQRWHKTRKNSLW-IPASEPVLGENVPTVLLLSKNTVSPTKIRYEMQLSG 782
            :.|:::.. ||.|.|.......|||  | :||.| |...|.....|:||..:....|:...:.:|
Mouse   729 AHCEEDAPLCGFPWYLPVHFLIRKN--WYLPAPE-VSPRNPAHFRLVSKEKMPWDSIKLTFEATG 790

  Fly   783 PNHMALFIQPLNGAKMMDWSFHQAPLRLSFEPPYFIYFSWGVNGDPLKFWLELEKPNGNWNSSTL 847
            |:||:.:::...|:.:..||........|....||:::|.|:.....:||:|:::.:.......:
Mouse   791 PSHMSFYVRTHKGSTLSQWSLGNGIPVTSRGGDYFVFYSHGLQASAWRFWIEVQQVSEEQAEGMV 855

  Fly   848 ELGLGGHW----NHHKELITPDFKKFLD-SFPHYVDATPWPASFESRIF 891
            .:.:..|:    |.....:....|||.| |||     :.|.:::...:|
Mouse   856 TVAIAAHYLSGENKRSSQLDALKKKFPDWSFP-----SAWVSTYSLFVF 899

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 134/307 (44%)
Ermp1NP_001349060.1 M28_Fxna_like 99..406 CDD:193497 134/307 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368777076
eggNOG 1 0.900 E1_COG2234
Hieranoid 1 1.000
Homologene 1 1.000 H121891
Inparanoid 1 1.050 426 1.000 Inparanoid score I1726
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000590
OrthoInspector 1 1.000 T615144
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12147
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.850

Return to query results.
Submit another query.