DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11961 and Tfrc

DIOPT Version :10

Sequence 1:NP_725876.1 Gene:CG11961 / 37221 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_035768.1 Gene:Tfrc / 22042 MGIID:98822 Length:763 Species:Mus musculus


Alignment Length:303 Identity:62/303 - (20%)
Similarity:104/303 - (34%) Gaps:95/303 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 QNIVVKISPKNT-----------------NSTTYLLVNSHYDSVPAGPGAGDDGSMVAT-----M 208
            ||..||:..||.                 ....|::|.:..|::.||..|   .|.|.|     :
Mouse   371 QNQNVKLIVKNVLKERRILNIFGVIKGYEEPDRYVVVGAQRDALGAGVAA---KSSVGTGLLLKL 432

  Fly   209 MEVLRVLAKSD--KPLKNPVVFLFNGAEENPLQASHAFITQHKWAK-YCKAL-------INLDSC 263
            .:|...:...|  :|.::.:...:...:...:.|:       :|.: |..:|       ||||..
Mouse   433 AQVFSDMISKDGFRPSRSIIFASWTAGDFGAVGAT-------EWLEGYLSSLHLKAFTYINLDKV 490

  Fly   264 GNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQ-HNFIPS------DTDFRIFRDHGS 321
            ..|.......:.|....||....:.:|||   ..|:.|:: .|:|..      |.....|..:..
Mouse   491 VLGTSNFKVSASPLLYTLMGKIMQDVKHP---VDGKSLYRDSNWISKVEKLSFDNAAYPFLAYSG 552

  Fly   322 VPGL------DMAYTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEIENSAKYAKG 380
            :|.:      |..|.|.|    ||.|..|               ||.:::   |::....:.|. 
Mouse   553 IPAVSFCFCEDADYPYLG----TRLDTYE---------------ALTQKV---PQLNQMVRTAA- 594

  Fly   381 HTIYFDVMGWFLVFYTETEGVILNVIVSLVSIGICGYAFKLMS 423
                 :|.|..::  ..|..|.||:...:       |..||:|
Mouse   595 -----EVAGQLII--KLTHDVELNLDYEM-------YNSKLLS 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11961NP_725876.1 M28_Fxna_like 91..395 CDD:349872 54/273 (20%)
MFS <539..>658 CDD:475125
TfrcNP_035768.1 Mediates interaction with SH3BP4. /evidence=ECO:0000250 1..67
Endocytosis signal 20..23
Stop-transfer sequence 58..61
PA_TfR 203..379 CDD:239043 4/7 (57%)
M28_TfR 387..613 CDD:349946 52/268 (19%)
Ligand-binding. /evidence=ECO:0000250 572..763 17/85 (20%)
TFR_dimer 640..753 CDD:461238
Cell attachment site. /evidence=ECO:0000255 649..651
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.