DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11961 and Tfrc

DIOPT Version :9

Sequence 1:NP_001246418.1 Gene:CG11961 / 37221 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001344227.1 Gene:Tfrc / 22042 MGIID:98822 Length:763 Species:Mus musculus


Alignment Length:303 Identity:62/303 - (20%)
Similarity:104/303 - (34%) Gaps:95/303 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 QNIVVKISPKNT-----------------NSTTYLLVNSHYDSVPAGPGAGDDGSMVAT-----M 208
            ||..||:..||.                 ....|::|.:..|::.||..|   .|.|.|     :
Mouse   371 QNQNVKLIVKNVLKERRILNIFGVIKGYEEPDRYVVVGAQRDALGAGVAA---KSSVGTGLLLKL 432

  Fly   209 MEVLRVLAKSD--KPLKNPVVFLFNGAEENPLQASHAFITQHKWAK-YCKAL-------INLDSC 263
            .:|...:...|  :|.::.:...:...:...:.|:       :|.: |..:|       ||||..
Mouse   433 AQVFSDMISKDGFRPSRSIIFASWTAGDFGAVGAT-------EWLEGYLSSLHLKAFTYINLDKV 490

  Fly   264 GNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQ-HNFIPS------DTDFRIFRDHGS 321
            ..|.......:.|....||....:.:|||   ..|:.|:: .|:|..      |.....|..:..
Mouse   491 VLGTSNFKVSASPLLYTLMGKIMQDVKHP---VDGKSLYRDSNWISKVEKLSFDNAAYPFLAYSG 552

  Fly   322 VPGL------DMAYTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEIENSAKYAKG 380
            :|.:      |..|.|.|    ||.|..|               ||.:::   |::....:.|. 
Mouse   553 IPAVSFCFCEDADYPYLG----TRLDTYE---------------ALTQKV---PQLNQMVRTAA- 594

  Fly   381 HTIYFDVMGWFLVFYTETEGVILNVIVSLVSIGICGYAFKLMS 423
                 :|.|..::  ..|..|.||:...:       |..||:|
Mouse   595 -----EVAGQLII--KLTHDVELNLDYEM-------YNSKLLS 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 54/273 (20%)
TfrcNP_001344227.1 Mediates interaction with SH3BP4. /evidence=ECO:0000250 1..67
Endocytosis signal 20..23
Stop-transfer sequence 58..61
PA_TfR 203..379 CDD:239043 4/7 (57%)
Zinc_peptidase_like 387..613 CDD:326366 52/268 (19%)
Ligand-binding. /evidence=ECO:0000250 572..763 17/85 (20%)
TFR_dimer 645..749 CDD:309400
Cell attachment site. /evidence=ECO:0000255 649..651
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.