DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and Y39A3B.1

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_497490.2 Gene:Y39A3B.1 WormBaseID:WBGene00021436 Length:371 Species:Caenorhabditis elegans

Alignment Length:194 Identity:45/195 (23%)
Similarity:84/195 (43%) Gaps:41/195 (21%)


  Fly    61 GFWLLLYVTISIPACHRLPRPLTIQDEETHPDQFIAERAEKNLRELVSLGPRVVGSRQNE----- 120
            |.:.||.:.:.|  |.......||.|         .:|.:.:|.:.:|:      ||.||     
 Worm     3 GLFKLLSIILGI--CQLALSLSTIAD---------MDRMKHDLSKFLSI------SRFNETEKSV 50

  Fly   121 -MAALKMLSQKMQKIRSGTANDIEVDVQVASGSYVHWSMVNMYQSIQNIVVKISPK-NTNSTTYL 183
             .||:|...:             .|.:...:.:::|.....:..::  |.|:..|. .|.:...:
 Worm    51 ARAAIKRALE-------------AVGLNSMTHTFIHEESNEVGANV--IAVQKGPYFGTGNDKMM 100

  Fly   184 LVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAKSDK--PLKNPVVFLFNGAEENPLQASHAFI 245
            :::::||::....|..|:||.||.::|..|||:..|.  ..:|.:|::|...:...|..||||:
 Worm   101 ILSANYDTLEGNQGVDDNGSGVAAVLEAARVLSTLDNLYSRQNTIVYVFFDMKHKALAGSHAFV 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 37/165 (22%)
Y39A3B.1NP_497490.2 M28 37..349 CDD:193493 35/150 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.