DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and C44B7.11

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_495410.4 Gene:C44B7.11 WormBaseID:WBGene00016631 Length:895 Species:Caenorhabditis elegans

Alignment Length:895 Identity:239/896 (27%)
Similarity:404/896 (45%) Gaps:124/896 (14%)


  Fly    59 FFG-FWLLLYV-TISIPACHRLPRPLTIQDEETHPDQFIAERAEKNLRELVSLGPRVVGSRQNEM 121
            |.| |:|:|.: |..:..|  ||.|.....|||   ||..:||.|.|:||...|.:..||...|.
 Worm    45 FIGLFFLVLIIGTTFLHKC--LPEPKDPNQEET---QFSEKRAVKVLQELSDYGWKPAGSYNCEE 104

  Fly   122 AALKMLSQKMQKIRSGTAN----DIEVDVQVASGSY---VH--WSMVNMYQSIQNIVVKISPKNT 177
            .....:.:::..|||...|    ..::|.|..||.:   .|  ..|...|:::.|::.::.....
 Worm   105 LTRNRILKELNDIRSQNQNVENLRFDIDTQYVSGCFDIPAHDTEGMNICYRNVSNVMARLGKGEK 169

  Fly   178 NSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAKSDKPLKNPVVFLFNGAEENPLQASH 242
            .....:|:|.||||.|......||.|..|.|:|::|:.:|:...|.:.|:||||||||:.|.|:|
 Worm   170 KDKISVLLNCHYDSWPTSNAGSDDLSSCALMLELIRLYSKNPHLLNHDVIFLFNGAEESSLLAAH 234

  Fly   243 AFITQHKWAKYCKALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQHNFI 307
            .|||||.|....:|.|||::.|:||||:|||:||.:.||:.:|..|..||:.|.:|:|:||....
 Worm   235 GFITQHSWRHEIRAFINLEASGSGGRELLFQAGPANQWLLNSYLEAAIHPHCSVIGQEVFQSGVY 299

  Fly   308 PSDTDFRIFRDHGSVPGLDMAYTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEIE 372
            |.|||||||||||.|||||:|:..||:.:||..|.||...:||.|..|:|:.:.:..:..||.:|
 Worm   300 PGDTDFRIFRDHGRVPGLDLAFVQNGYWWHTEFDTAERITKGSLQRAGENVYSTLNHLLKSPYLE 364

  Fly   373 NSAKYAKGHTIYFDVMGWFLVFYTETEGVILNVIVSLVSIGICGYAFKLMSVNSGIKLEKILKKV 437
            ..|:||...|::||.:|.|::.|..:...::|::.....|.:..:.|...:..:.:.|.      
 Worm   365 KPAEYADRKTVFFDFLGLFVIIYPLSIAHLVNMLTICTVIALMSHRFYSKTFITFLALR------ 423

  Fly   438 GHTLLVQILSVVVGAILPVLLGLFMDAVHLPLSWFSNSWLILGLY-FTTFFFGLAIVPALYFHWT 501
            .:.|.:..:::|:.|:  ..:.||   .:..|.|::..||.|..| ..:.:.|:::...|.....
 Worm   424 DYVLTILTIALVLKAM--TFMSLF---TYGALRWYTRHWLALVAYGLPSVWAGISVQGLLTARLA 483

  Fly   502 KRDKLPIGQRVQLLLHCHCLLLSVLTLIFTICGIRSVFVLMLSCLFYTVGLIINIATKLHTKDVA 566
            .:.:...|..::|:   |..|:|.:.|.||...|.|.|:..|        |::.....:.|...|
 Worm   484 PKAREEYGSTLELI---HLTLISGILLAFTYYDIASGFLFAL--------LLVPAIKSIITYFGA 537

  Fly   567 W-------VIPHIVCTVPPFVFFAYFSHGFFTTFIPMFGRFGENLNPDLAVAVFSVAVGFLCCGF 624
            |       .|..::.:.|......|.:....:.|||:.||  .:.||:.||:.|   |.|.....
 Worm   538 WPTCPTFNTILTLILSFPGCAMAIYTTEMLLSIFIPIMGR--SSYNPEPAVSFF---VAFSAGCI 597

  Fly   625 IIPVLQLFNKSKT-----------IICGLMGITLLCFIIAMTPIGF---PYRPET---NVQRFAV 672
            ::.:..|..||:.           :|..::|:.|:...|......|   |||.:.   ..:|...
 Worm   598 VLSLGGLVAKSRNSRSSNEAGLLELIYNILGVLLVTLTILYVFSSFWPSPYRFDNVYPTAKRTQF 662

  Fly   673 LHTKRTFHDAQNKVRRQESGYFIMPQDRR-----TYTVKNAVINMTLAQRIGSDCDKEIN--CGL 730
            .|..:..:|...::...::.::.:..|.|     .:..|:       .:..|..|..|.|  |..
 Worm   663 FHVNQMLYDRNGQISVNDTRFYAISHDYRGAEDIPFVKKD-------PEYTGLQCHYENNPWCET 720

  Fly   731 PL-------YNQRWHKTRKNSLWIPASEPVLGENVPTVLLLSKNTVSPTK-----IRYEMQLSGP 783
            |.       .|:|..:.|.....:....||      .:|.:||.....:|     |.|...:.|.
 Worm   721 PFLFPTKGRLNERNIRVRSVDERLKFKHPV------KILGISKRHGVDSKDGKGNIEYSFSVIGT 779

  Fly   784 NHMALFIQPLNGAKMMDWSFHQ--APLRLSFEPPYFIYFSWGVNGDPLKFWLEL------EKPNG 840
            ..::::|.|.....:.:.|..|  .|     :...|:|::.....:..::..::      :.|: 
 Worm   780 GQISVYIIPDTTWLITNTSVTQPKTP-----QENMFLYYTCSTPNNICEWMFKVTIKKTTQTPS- 838

  Fly   841 NWNSSTLELGLGGHWNHHKELITPDFKKFLDSF-------PHY-VDATPW 882
              :...|.:|:..|:.|..|:.:...|..:...       |.: |.|:.|
 Worm   839 --DDKPLLIGISSHYLHGPEMQSESIKNMIAKIQENRVNSPEWTVTASAW 886

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 124/313 (40%)
C44B7.11NP_495410.4 M28_Fxna_like 75..387 CDD:193497 125/315 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D152011at33208
OrthoFinder 1 1.000 FOG0000590
OrthoInspector 1 1.000 T98069
orthoMCL 1 0.900 OOG5_128724
Panther 1 1.100 O PTHR12147
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1738
TreeFam 1 0.960
109.820

Return to query results.
Submit another query.