DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and gcp-2.2

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_509928.3 Gene:gcp-2.2 WormBaseID:WBGene00007954 Length:779 Species:Caenorhabditis elegans

Alignment Length:389 Identity:86/390 (22%)
Similarity:143/390 (37%) Gaps:102/390 (26%)


  Fly   160 NMYQSIQNIVVKISPKNTNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAKSDK---- 220
            |..:.||||:..|. .:.....::||::|||:...  ||.|..|..:|::||.|.|.:...    
 Worm   368 NEERKIQNIMGYIK-GSQEPDKFVLVSNHYDAWTY--GAVDPNSGTSTLLEVSRALKQYQNQTGW 429

  Fly   221 -PLKNPVVFLFNGAEENPLQASHAFITQHK--WAKYCKALINLDSCGNGGREILFQSGPNHPWLM 282
             |.:: ::|....|||..|..|..|..:::  ..:...|:||:|..| |.:.:|..|.|....::
 Worm   430 IPARS-ILFAHWDAEEYGLIGSTEFAEEYRLQLMRRAVAVINMDLIG-GNQTLLGLSNPTVANVL 492

  Fly   283 KNYRRAIKHPYASTM--GEELFQHN---FIPSDTDFRIFRDHGSVPGLDMAYTYNGFVYHTRHDK 342
            ::....::.|..:.|  |.:....:   :.||..:                        .:.|..
 Worm   493 RSAAANVEQPNPTEMEQGRKTLYDSWKYYAPSKNN------------------------RSTHPY 533

  Fly   343 AEIFPRGS-----FQHTGDNLLALVRQIANSPEIENSAKYAKGHTIYFDVMGWFLVFYTETEGVI 402
            ..|...||     |.:.|..::..:....::|     ..|...||||            ||..:|
 Worm   534 QRIPAGGSDHLPFFDYLGIPIVFFITSSLDAP-----PTYPLYHTIY------------ETPYLI 581

  Fly   403 LNVIVSLVSIGICGYAFKLMSVNSGIKLEKILKKVGHTLLVQILSVVVGAILPVLLGLFMD---A 464
            .|::..       ||              |:.|.:....:..||......|||..|...||   .
 Worm   582 ENIMDP-------GY--------------KVHKAIAGMFIECILKFTESKILPYDLNELMDDSIF 625

  Fly   465 VHLP-LSWFSNSWLILGLYFTTFF------FGLAIVPALYF-------HWTKRDKLPIGQRVQL 514
            .:|| |....|..|::|.. |.:.      |.|.....|..       :.:|.::||.|.||.:
 Worm   626 EYLPKLEDRLNKTLMIGTK-TDYLLDAQKQFKLLQKTVLELSEIVQRRNVSKLEELPFGSRVDI 688

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 54/252 (21%)
gcp-2.2NP_509928.3 Zinc_peptidase_like 75..>133 CDD:301362
PA_GCPII_like 137..364 CDD:239036
M28_PSMA_like 372..614 CDD:193568 66/309 (21%)
TFR_dimer 652..773 CDD:282153 9/38 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.