DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and B0495.7

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_495618.1 Gene:B0495.7 WormBaseID:WBGene00015206 Length:895 Species:Caenorhabditis elegans

Alignment Length:864 Identity:268/865 (31%)
Similarity:413/865 (48%) Gaps:119/865 (14%)


  Fly    60 FGFWLLLYVTISI-----PACHR-LPRPLTIQDEETHPDQFIAERAEKNLRELVSLGPRVVGSRQ 118
            |..|:...:|::|     .|.|| :|   .::|..:..| |..:||...|::|.:||.|..||..
 Worm    37 FRHWIYFVLTVAIVYAGVVALHRKMP---AVRDGTSFED-FSEQRARVLLKQLTALGSRPSGSDN 97

  Fly   119 NEMAALKMLSQKMQKIRSGT----ANDIEVDVQVASGSY---VHWSMVNMYQSIQNIVVKISPKN 176
            .|:.|..|:..::.||.|..    .|.:|.|||..||.:   ...|....|..|.|:||:|.||.
 Worm    98 LEVKAFGMIQDRIGKIHSVVDEVGVNRLESDVQRPSGCFDLKFLSSFTLCYHKITNVVVRIGPKK 162

  Fly   177 TNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLAKSDKPLKNPVVFLFNGAEENPLQAS 241
            ..|...||:|.|:|::|..|||.||......||:||.|||.|...|:|.|||||||||||.|||:
 Worm   163 GPSGNSLLLNCHFDTMPDTPGATDDAVACTIMMDVLEVLAHSKTELENDVVFLFNGAEENFLQAA 227

  Fly   242 HAFITQHKWAKYCKALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQHNF 306
            |.||.||.|....:|.|||:..|:||||||||:||.:.||::.|.....||:.|.:.:|:||...
 Worm   228 HGFINQHPWRHDIRAFINLEGTGSGGREILFQAGPGNSWLLQTYLENAPHPFCSVLAQEIFQSGI 292

  Fly   307 IPSDTDFRIFRDHGSVPGLDMAYTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEI 371
            ||||||||||||:|.:.|||:|||.||:.|||..|:......|:.|..|:|:||:||.|..||.:
 Worm   293 IPSDTDFRIFRDYGRISGLDIAYTKNGWFYHTEFDEEWRIEPGAIQRAGENVLAVVRAILKSPYL 357

  Fly   372 ENSAKY-AKGHTIYFDVMGWFLVFYTETEGVILNVIV--------------SLVSIGICGYAFKL 421
            |..|.: .:...:::||:|.|.|:|:...|.:||.|.              .|.|:|....||| 
 Worm   358 EKPATFDEENRWVFYDVVGLFTVYYSVNVGKLLNYIACFATYFLVVLRIRNRLYSVGDLAIAFK- 421

  Fly   422 MSVNSGIKLEKILKKVGHTLLVQILSVVVGAILPVLLGLFMDAVHLPLSWFSNSWLILGLYFTTF 486
                             |. :|..|::|:..:|.:...:.||.|   :.|:....::..||....
 Worm   422 -----------------HH-VVAFLAMVITMLLIIAFVVQMDLV---MCWYKMPEIVGALYVLPM 465

  Fly   487 FFGLAIVPALYFHWTKRDKLPIGQRVQLLLHCHCLLLSVLTLIFTICGIRSVFVLM----LSCLF 547
            ....|||   :.|:...:::...:.||.    ..:|||..:::|          ||    ||..|
 Worm   466 LIAGAIV---HSHYADNNRIRNVEMVQY----DTILLSFASILF----------LMTFYNLSSAF 513

  Fly   548 YTVGLIINIATKLHTKDVAW----------VIPHIV------CTVPPFVFFAYFSHGFFTTFIPM 596
            |.:.   |:...:....:.|          |.|.::      |.:|.|||.||........|:|:
 Worm   514 YVLN---NLILPVFKDIIIWALGLFGVIRRVTPRVLFFTQLFCFLPTFVFAAYAISQCVDFFVPV 575

  Fly   597 FGRFGENLNPDLAVAVFSVAVGFLCCGFIIPVLQLFNKSKT---IICGLMGI-TLLCFIIAMTPI 657
            .||.|..:||:..:....:.:   ..|||:.|..||..|:.   ||..|..| .|...::..|.:
 Worm   576 MGRLGNAINPEFIMGPLGLVI---ASGFILFVNNLFYISRRMNYIIRLLFAIFALFILVLITTKV 637

  Fly   658 GFPY---RPETNVQRFAVLHTKRTFHDAQNKVRRQESGYFIMPQDRRTYTVKNAVINMTLAQRIG 719
            |.||   .....::|...||..||.:|.:..:.::::..|:...|.|  ...:...:..|.....
 Worm   638 GNPYEYSHENPRLRRIIALHANRTIYDFEGHLTQKDNALFVHSLDYR--GASDLPDHSFLQGSSA 700

  Fly   720 SDCDKEIN--CGLPLYNQRWHK--TRKNSLWIPASEPVLGENVPTVLLLSKNTVSPT-KIRYEMQ 779
            .:|...::  |.:|.|. ..|:  ..:.|||:|...||:......:.|:|::.:... .:.:|::
 Worm   701 PNCTGVVDEYCRMPYYT-AIHELFPPEQSLWVPVPSPVVLPYPIDLKLVSRHAMGENLNLTFEIR 764

  Fly   780 LSGPNHMALFIQPLNGAKMMDWSFHQAPLR-LSFEPPYFIYFSWGVNGDPL-KFWLELEKPNG-- 840
             .|.:.|:|.:.|||...::.|||....:: ......||::.::|.....: :||:.|:..||  
 Worm   765 -GGYDKMSLHVTPLNDYDLLSWSFTDIDIKEFGRRQTYFVFMTYGHEAPEVRRFWILLKNKNGVA 828

  Fly   841 --NWNSSTLELGLGGHWNH 857
              ......:||.:..|:.|
 Worm   829 PDPEKHENIELSVATHYAH 847

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 142/312 (46%)
B0495.7NP_495618.1 M28_Fxna_like 70..382 CDD:193497 142/313 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368256993
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H121891
Inparanoid 1 1.050 359 1.000 Inparanoid score I1280
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D152011at33208
OrthoFinder 1 1.000 FOG0000590
OrthoInspector 1 1.000 T98069
orthoMCL 1 0.900 OOG5_128724
Panther 1 1.100 O PTHR12147
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1738
TreeFam 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.