DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and CPQ

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_057218.1 Gene:CPQ HGNCID:16910 Length:472 Species:Homo sapiens

Alignment Length:236 Identity:47/237 (20%)
Similarity:82/237 (35%) Gaps:61/237 (26%)


  Fly   128 SQKMQKIRSGTANDIEVDVQVASGSYVHWSMVNMYQSIQNIVVKISPKNTNSTTYLLVNSHYDSV 192
            ::.|.::.|   :.|::.:|:..|:.. :...:.:.::..|.....|:..     :||:.|.||.
Human   239 AEMMSRMAS---HGIKIVIQLKMGAKT-YPDTDSFNTVAEITGSKYPEQV-----VLVSGHLDSW 294

  Fly   193 PAGPGAGDDGSMVATMMEVLRVLAKSDKPLKNPVVFLFNGAEENPLQASHAFITQHKWAKYCKAL 257
            ..|.||.|||.......|.|.::.......|..:..:...|||.....:..:...||        
Human   295 DVGQGAMDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLHK-------- 351

  Fly   258 INLDSCGNGGREILFQSGPNHPWLMKN----------------YRRAIKHPYASTMG----EELF 302
            :|:.               |:..:|::                ..|||.....|.:.    .::.
Human   352 VNIS---------------NYSLVMESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVL 401

  Fly   303 QHNFIPSDTDFRIFRDHGSVPG---LDMAYTYNGFVYHTRH 340
            .|.   ..||...:...| |||   ||..|.|  |.:|..|
Human   402 SHG---EGTDINFWIQAG-VPGASLLDDLYKY--FFFHHSH 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 47/237 (20%)
CPQNP_057218.1 M28_Pgcp_like 47..449 CDD:193504 47/237 (20%)
PA_M28_2 130..256 CDD:240119 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.