DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and LOC100330918

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_002665878.5 Gene:LOC100330918 ID: Length:354 Species:Danio rerio

Alignment Length:362 Identity:85/363 (23%)
Similarity:149/363 (41%) Gaps:62/363 (17%)


  Fly   546 LFYTVGLIINIATKLHTKDVAWVIPHIVCTVPPFVFFAYFSHGFFTTFIPMFGRFGENLNPDLAV 610
            :||.:||.:   ..:|...:.||:                    |..|.|:.||.|..:.||:.:
Zfish    29 VFYLMGLSV---PYVHIMFLIWVV--------------------FEIFTPILGRSGTEIPPDVVL 70

  Fly   611 AVFSVAVGFLCCGFIIPVLQLFNKSKTIICGLMGITLLCFIIAMTPIGFPY-------RPETNVQ 668
            |........:...:::.:|.|...:|.::..|..:..:.|::....:.|||       ||    :
Zfish    71 AALITLAAVILSSYLMHLLYLSCSTKRMLAALGSVFAVMFVLVGCGLFFPYSADPSSPRP----K 131

  Fly   669 RFAVLHTKRTFHDAQNKVRRQESGYFIMPQDRRTYTVKNAV------INMTLAQRIGSDCDKEI- 726
            |..|.||.|.||.....|.|.:||.:|...|   ||....:      :|.::..|    |...: 
Zfish   132 RVFVQHTTRVFHALDGSVERSDSGLWINSLD---YTGMQHISAHVPQLNDSIRTR----CQHTLP 189

  Fly   727 NCGLPLYNQRWHK----TRKNSLWIPASEPVLGENVPTVL-LLSKNTVSPTKIRYEMQLSGPNHM 786
            .||.|     |..    ..|.|.::||  |.:....|... |||:.......:|...:..||.||
Zfish   190 YCGFP-----WFLPVKFLVKKSWYLPA--PAVSPEAPLEFRLLSRQQSEWGTLRLSFEAKGPTHM 247

  Fly   787 ALFIQPLNGAKMMDWSFHQAPLRLSFEPPYFIYFSWGVNGDPLKFWLELEK--PNGNWNSSTLEL 849
            :|::.|::||.::.|||.....|......|||::|.|.:....:|.||::.  .:.:.:...|.|
Zfish   248 SLYLLPVSGASLIGWSFGDGTPRFDLSGEYFIFYSHGTDAPAWRFSLEVQPGVSDASPDEGLLSL 312

  Fly   850 GLGGHWNHHKELITPDFKKFLDSFPHYVDATPWPASF 886
            .:..|:....:..:|.....:.:||.:...:.|.:::
Zfish   313 AISAHYFSGPDKHSPPLHTLISTFPDWAFPSAWSSTY 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497
LOC100330918XP_002665878.5 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D152011at33208
OrthoFinder 1 1.000 FOG0000590
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128724
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.