DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and ermp1

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_004910853.1 Gene:ermp1 XenbaseID:XB-GENE-984733 Length:876 Species:Xenopus tropicalis

Alignment Length:871 Identity:262/872 (30%)
Similarity:434/872 (50%) Gaps:89/872 (10%)


  Fly    64 LLLYVTISIPACHRLPRPLTIQDEETHPDQFIAERAEKNLRELVSLGPRVVGSRQNEMAALKMLS 128
            |||||.......|...|.|....  .|...|.|..|.:.|:::.|:..|:|||.:||:.|:..|.
 Frog    52 LLLYVLGVRGLVHISLRQLVTPG--GHSTGFNASTAREYLQQITSIDSRIVGSPENEIIAVDYLL 114

  Fly   129 QKMQKI--RSGTANDIEVDVQVASGSY---VHWSMVNMYQSIQNIVVKISPKNTNSTTYLLVNSH 188
            .|::.|  :..:.:.|.||||..:|::   ......:.|.:|.||.||:.|: ..:...:|.|.|
 Frog   115 GKIKDIEEKVNSVHKITVDVQRPTGTFSIDFLGGFTSYYDNITNIAVKLEPE-FGAEHAVLANCH 178

  Fly   189 YDSVPAGPGAGDDGSMVATMMEVLRVLAKSDKPLKNPVVFLFNGAEENPLQASHAFITQHKWAKY 253
            :|||...|||.||....|.|:|:|..|:.|.|||::.::|||||||||.||.||.|||||.|||.
 Frog   179 FDSVANTPGASDDAVSCAVMLEILGSLSVSSKPLRHAIIFLFNGAEENILQGSHGFITQHPWAKM 243

  Fly   254 CKALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQHNFIPSDTDFRIFRD 318
            .:|.|||::.|.||:|::||:||.:|||::.|..|..||:||.:.:|:||...|||||||||:||
 Frog   244 VRAFINLEAAGVGGKELVFQTGPENPWLVQAYALAAVHPFASVVAQEVFQSGIIPSDTDFRIYRD 308

  Fly   319 HGSVPGLDMAYTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEIENSAKYAKGHTI 383
            .|::||:|:|:..||::|||::|........|.|..|||:|.::..:|.|.::..|:|:..|:.:
 Frog   309 FGNIPGIDLAFIENGYIYHTKYDTWNRILTESIQRAGDNILGVLHYLATSSQLAESSKFRHGNMV 373

  Fly   384 YFDVMGWFLVFYTETEGVILNVIVSLVSIGICGYAFKLMSVNSGIKLEKILK-KVGHT------- 440
            :|||.|.|::.|....|.|:|.|.:.|::...|              :||:| |.|.|       
 Frog   374 FFDVCGLFVLSYPARLGTIINYITAAVTLFYIG--------------KKIIKYKQGGTNYARDLV 424

  Fly   441 --LLVQILSVVVGAILPVLLGLFMDAVHLPLSWFSNSWLILGLYFTTFFFGLAIVPALY------ 497
              .|:.::|.|...:..:::.:.:......|.|:::      .|.:.|.:|.|.|..|.      
 Frog   425 YGFLITLVSWVSALVTVLIIAVLVSLAGKALFWYTH------FYVSVFLYGSAAVAKLILVHSLA 483

  Fly   498 --FHWTKRDKLPIGQ---RVQLLLHCHCLLLSVLTLIFTICGIRSVFVLMLSCLFYTVGLIINIA 557
              |.:.......:|.   .:.|::.|..|:|      .|..|:.|.:       |:...:|..:.
 Frog   484 KTFFFAGASSQYLGDVFFDISLIIWCIPLVL------LTQSGLCSAY-------FFAAWIIFPLL 535

  Fly   558 TKLHTK-DV-------AWVIPHIVCTVPPFVFFAYFSHGFFTTFIPMFGRFGENLNPDLAVAVFS 614
            |||..: |:       .:.:.:::...||::...|.....|..|.|:.||.|..:.||:.:....
 Frog   536 TKLLLQPDIIHQGSPYKFTVIYLLGLFPPYLHTMYHVWAVFEMFTPILGRSGTEIPPDVVLGFLI 600

  Fly   615 VAVGFLCCGFIIPVLQLFNKSKTIICGLMGITLLCFIIAMTPIGFPYRPETN---VQRFAVLHTK 676
            :|...:...:.|..:.|...:|.||..|..:::|.|::..:.:.|||...|:   .:|..:.||.
 Frog   601 IACTIMLISYFISFIYLVKNTKNIIVPLAVLSVLTFLLVCSGMFFPYSSSTDSPKPKRIFLQHTT 665

  Fly   677 RTFHDAQNKVRRQESGYFIMPQDRRTYTVKNAVINMT-----LAQRIGSDCDKEINCGLPLYNQR 736
            ||||....:|.:::||.:|...|   ||   .:.::|     |...:.:.||....||.|.|...
 Frog   666 RTFHSLTGEVVKKDSGIWINGFD---YT---GISHVTPHFPELNDTVRAPCDDAPLCGFPWYFPV 724

  Fly   737 WHKTRKNSLW-IPASEPVLGENVPTVLLLSKNTVSPTKIRYEMQLSGPNHMALFIQPLNGAKMMD 800
            .:..|||  | :||....:.|:. ...|:|:..:|....|...:..||:||.::::|...:.:..
 Frog   725 HNLIRKN--WYLPAPPAPIYEHT-EFKLVSREEMSWGTTRLHFEAKGPSHMTVYVRPHADSVLSS 786

  Fly   801 WSFHQAPLRLSFEPPYFIYFSWGVNGDPLKFWLELEKPNGNWNSSTLELGLGGHWNHHKELITPD 865
            ||........|.|..|||::|.|:.....|||:|: |.:.:.:...:.:.:|.|:.......:|.
 Frog   787 WSLGDGIPIASGEKDYFIFYSHGLYAPAWKFWIEV-KNSADESKGIVTVAVGSHYFFGDSRNSPH 850

  Fly   866 FKKFLDSFPHYVDATPWPASFESRIF 891
            .|.....||.:...:.|..:::..::
 Frog   851 LKTVELKFPDWSFPSSWVCTYDLYVY 876

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 131/309 (42%)
ermp1XP_004910853.1 M28_Fxna_like 78..385 CDD:193497 131/308 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368776725
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H121891
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D152011at33208
OrthoFinder 1 1.000 FOG0000590
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.800

Return to query results.
Submit another query.