DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and NAALADL1

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_005459.2 Gene:NAALADL1 HGNCID:23536 Length:740 Species:Homo sapiens

Alignment Length:390 Identity:82/391 (21%)
Similarity:133/391 (34%) Gaps:117/391 (30%)


  Fly    18 DPTNV-DPLLRPRGS--QQYEAQPNGCERAFVQGNKIKWFWAPAFFGFWLLLYVTISIPACHRL- 78
            ||.:: |.|..|..:  ..:...|:|.||    |:..::|..|      |..|:. ::|:..|: 
Human   218 DPADINDGLSSPDETFPNSWYLPPSGVER----GSYYEYFGDP------LTPYLP-AVPSSFRVD 271

  Fly    79 --------PRPLTIQDEETHPDQFIAERAEKNLRELV--------------------SLGPRVVG 115
                    |.|       |.|..|      ::.|:|:                    .|||   |
Human   272 LANVSGFPPIP-------TQPIGF------QDARDLLCNLNGTLAPATWQGALGCHYRLGP---G 320

  Fly   116 SRQNEMAALKMLSQKMQKIRSGTANDIEVDVQVASGSYVHWSMVNMYQSIQNIVVKISPKNTNST 180
            .|.:                    .|...|.||....|....:.|....:..|...:.|..    
Human   321 FRPD--------------------GDFPADSQVNVSVYNRLELRNSSNVLGIIRGAVEPDR---- 361

  Fly   181 TYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLA----KSDKPLKNPVVFLFNGAEENPLQAS 241
             |:|..:|.||..  .||.|..|..|.::|:.|||.    |.....:..:||...||||..|..|
Human   362 -YVLYGNHRDSWV--HGAVDPSSGTAVLLELSRVLGTLLKKGTWRPRRSIVFASWGAEEFGLIGS 423

  Fly   242 HAFITQ--HKWAKYCKALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQ- 303
            ..|..:  :|..:...|.||:|........:..|..|....::.:..:.|:.|....:  .::. 
Human   424 TEFTEEFFNKLQERTVAYINVDISVFANATLRVQGTPPVQSVVFSATKEIRSPGPGDL--SIYDN 486

  Fly   304 -----------HNFIPS------DTDFRIFRDHGSVPGLDMAYTY-----NGFVYHTRHDKAEIF 346
                       :..:||      .:|:..|.....:..:|:||||     :..:|.|.|...:.|
Human   487 WIRYFNRSSPVYGLVPSLGSLGAGSDYAPFVHFLGISSMDIAYTYDRSKTSARIYPTYHTAFDTF 551

  Fly   347  346
            Human   552  551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 63/306 (21%)
NAALADL1NP_005459.2 Zinc_peptidase_like 51..>132 CDD:301362
PA_GCPII_like 109..335 CDD:239036 32/164 (20%)
M28_PSMA_like 332..587 CDD:193568 52/230 (23%)
TFR_dimer 621..735 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.