DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and tfrc

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_017949664.1 Gene:tfrc XenbaseID:XB-GENE-487708 Length:776 Species:Xenopus tropicalis

Alignment Length:369 Identity:68/370 (18%)
Similarity:123/370 (33%) Gaps:121/370 (33%)


  Fly    91 PDQFIAERAEKNLRELV-------------SLGPRVVGSRQNEMAALKMLSQKMQKIRSGTANDI 142
            |.|.|:....|.|.|.:             .|||::..::..::....:|.:|            
 Frog   344 PVQTISSEDGKKLLEKLEGADCPKTWQVPFKLGPQMKDTQNIKLEVTNVLVEK------------ 396

  Fly   143 EVDVQVASGSYVHWSMVNMYQSIQNIVVKISPKNTNSTTYLLVNSHYDSVPAGPGAGDDGSMVAT 207
                          .:.|::..||..        ..|..|::|.:..||  .|||........:.
 Frog   397 --------------KIYNVFGIIQGF--------EQSDHYVVVGAQRDS--WGPGVAKTAVGTSI 437

  Fly   208 MMEVLRVLA---KSD--KPLKNPVVFLFNGAEENPLQASHAFITQHKWAK------YCKAL--IN 259
            ::|:.::|:   |:|  :| :..:||...||      .....:...:|.:      :.||.  ||
 Frog   438 LLELAKLLSDMVKTDGFRP-RRSIVFASWGA------GDFGSVGATEWLEGYLNNLHLKAFSYIN 495

  Fly   260 LDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYA------STMGEELFQHNFIPSDTDFRI--- 315
            |||...|.......:.|....::....:.:..|.:      :.:|.:.:....:|    |.|   
 Frog   496 LDSAIQGAGTFQVSASPLMNRVILQTLKEVSDPVSTDFTLYTQLGSQAWTKKIVP----FSIEDS 556

  Fly   316 ---FRDHGSVPGLDMA-------YTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSP- 369
               |..:..:|.:..:       |.|.|    |:.|..|     :|:...| |..:.|..||.. 
 Frog   557 AYPFLAYSGIPSVSFSFQKENKPYAYLG----TKMDTLE-----NFKQLVD-LDRMCRTAANFAA 611

  Fly   370 ----EIENSAKYAKGHTIYFDVMGWFLVFYTETEGVILNVIVSL 409
                .:.:..|....::.|.|              |.|||.:.|
 Frog   612 QIIMRLTHEQKLPLDYSSYSD--------------VFLNVSIDL 641

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 63/354 (18%)
tfrcXP_017949664.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.