DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11961 and NAALAD2

Sequence 1:NP_001246418.1 Gene:CG11961 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_016872532.1 Gene:NAALAD2 HGNCID:14526 Length:775 Species:Homo sapiens

Alignment Length:365 Identity:79/366 (22%)
Similarity:126/366 (34%) Gaps:104/366 (28%)


  Fly    70 ISIPACHRLP-RPLTIQDEE---------THPDQFIAERAEKN-LRELVSLGPRVVGSRQNEMAA 123
            :.||   |:| .|:...|.|         ..||     ::.|. |....|:||...|        
Human   312 VGIP---RIPVHPIGYNDAEILLRYLGGIAPPD-----KSWKGALNVSYSIGPGFTG-------- 360

  Fly   124 LKMLSQKMQKIRSGTANDIEVDVQVASGSYVHWSMVNMYQSIQNIVVKISPKNTNSTTYLLVNSH 188
                |...:|:|                  :|...:|....|.|:|..|. .:.....|:::..|
Human   361 ----SDSFRKVR------------------MHVYNINKITRIYNVVGTIR-GSVEPDRYVILGGH 402

  Fly   189 YDSVPAGPGAGDDGSMVATMMEVLR----VLAKSDKPLKNPVVFLFNGAEENPLQASHAFITQHK 249
            .||...  ||.|..|.||.:.|:.|    :::|..:| :..::|....|||..|..|      .:
Human   403 RDSWVF--GAIDPTSGVAVLQEIARSFGKLMSKGWRP-RRTIIFASWDAEEFGLLGS------TE 458

  Fly   250 WA--------KYCKALINLDSCGNGGREILFQSGPNHPWLMKNYRRAIKHPYASTMGEELFQH-- 304
            ||        :...|.||.||...|...:.....|....|:....:.|..|......:.|::.  
Human   459 WAEENVKILQERSIAYINSDSSIEGNYTLRVDCTPLLYQLVYKLTKEIPSPDDGFESKSLYESWL 523

  Fly   305 --------------NFIPSDTDFRIFRDHGSVPGLDMAYT-------YNGF-VYHTRHDKAEIFP 347
                          |.:.|.:||..:.....:......||       |:.: ||||.::..|:..
Human   524 EKDPSPENKNLPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIYETFELVE 588

  Fly   348 RGSFQHTGDNLL-------ALVRQIANSPEIE-NSAKYAK 379
            : .:..|....|       |||.::.:|..|. |...||:
Human   589 K-FYDPTFKKQLSVAQLRGALVYELVDSKIIPFNIQDYAE 627

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 72/335 (21%)
NAALAD2XP_016872532.1 Zinc_peptidase_like 93..>139 CDD:301362
PA_GCPII_like 145..371 CDD:239036 19/97 (20%)
M28_PSMA_like 373..620 CDD:193568 57/258 (22%)
TFR_dimer 657..772 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.