DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7461 and CG3902

Sequence 1:NP_001286611.1 Gene:CG7461 FlyBaseID:FBgn0034432 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_649069.2 Gene:CG3902 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster

Alignment Length:411 Identity:138/412 (33%)
Similarity:215/412 (52%) Gaps:41/412 (10%)


  Fly    47 MANIFR---GSLVSSQVFPYP-DVLTAEQK-------ELTNSLIDPFERFFSDVNDAARNDANSK 100
            :||..|   .::.|:...|.| ..||.::|       :|....|.|..:         :.|...|
  Fly    13 LANAARQQSAAMSSATGLPPPLTFLTDDEKMMKETVAKLAQEQIQPLVK---------KMDFEHK 68

  Fly   101 IDDTTSTALWELGAFGIQVPSEFGGLGLNNTQYGRLCAIVGVNDL-----GLGITIGAHQSIGFK 160
            .|.:...|::|.|..||::.:|.||.|.|     .:..||.|.:|     .:...:..|.::...
  Fly    69 FDPSVVKAVFENGLMGIEIDTELGGSGCN-----FMTNIVVVEELSKIDPAVAAFVDIHNTLVNS 128

  Fly   161 GILLYGTPEQKEKYLPKVAAEQVYA-AFALTEPSSGSDAGSIRCRAVKSADGKHYVLNGSKIWIS 224
            .::.:|..|||.|||||:|.|  || :||||||.:||||.|::..|.|  ||.|||:||||:|||
  Fly   129 LMIKFGNAEQKAKYLPKLAQE--YAGSFALTEPGAGSDAFSLKTVAKK--DGSHYVINGSKMWIS 189

  Fly   225 NGGIAEIMTVFAQTEQVDPKTGEKKDKVTAFIVERSFGGVTNGPPEKKMGIKASNTAEVYFEDVK 289
            |..:|.:..:||..:..|...|     :|.|||:|...|:....||.|:||:||.|.::.|::|:
  Fly   190 NSDVAGVFLIFANAKPEDGYRG-----ITTFIVDRETPGLIVNKPEDKLGIRASGTCQLTFDNVR 249

  Fly   290 IPIENVLGKEGDGFKVAMNILNNGRFGMGATLSGTMKKCIEQATEHANNRVQFGQKLKNYGSIQE 354
            :|.||:||..|.|:|.|...||.||.|:.|.:.|..:...:....:...|.|||..:.|:.|:|.
  Fly   250 VPEENILGTFGHGYKYAAGFLNEGRIGIAAQMVGLAQGTFDATIPYLLERKQFGDAIYNFQSMQH 314

  Fly   355 KLAQMNILQYATESMAFTISQNMDAGSKDYHLEAAISKIYASESAWYVCDEAIQILGGMGYMVDN 419
            ::|.:.....|...|.:..::..:.| ..:..|||::|.||||.|.....:.:..:||:|:..|.
  Fly   315 QIATVATEIEAARLMTYNAARLQEQG-VPFQKEAAMAKYYASEVAQRAAIKCVDWMGGVGFTRDF 378

  Fly   420 GLERVLRDLRIFRIFEGTNDI 440
            ..|:..||::|..|:|||.::
  Fly   379 PQEKYYRDVKIGAIYEGTTNM 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7461NP_001286611.1 VLCAD 45..454 CDD:173850 138/412 (33%)
CaiA 67..446 CDD:224871 132/388 (34%)
CG3902NP_649069.2 CaiA 37..414 CDD:224871 132/388 (34%)
SCAD_SBCAD 39..410 CDD:173847 130/386 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107293358
eggNOG 1 0.900 E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43884
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.